![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | C.cajan_21534 | ||||||||
| Common Name | KK1_022169 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 86aa MW: 9683.06 Da PI: 10.7162 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 60.6 | 1.9e-19 | 15 | 48 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
C +C +t+Tp+WR+gp g+ktLCnaCG++yr+ +
C.cajan_21534 15 CMHCEVTSTPQWREGPMGPKTLCNACGVRYRSGR 48
99*****************************987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50114 | 11.978 | 9 | 45 | IPR000679 | Zinc finger, GATA-type |
| SMART | SM00401 | 5.4E-16 | 9 | 59 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 1.62E-15 | 11 | 71 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 1.6E-15 | 13 | 46 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 2.52E-13 | 14 | 61 | No hit | No description |
| PROSITE pattern | PS00344 | 0 | 15 | 40 | IPR000679 | Zinc finger, GATA-type |
| Pfam | PF00320 | 3.2E-17 | 15 | 49 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 86 aa Download sequence Send to blast |
MKRSSSQESV ATRKCMHCEV TSTPQWREGP MGPKTLCNAC GVRYRSGRLF AEYRPAASPT 60 FVASLHSNSH KKVLEIRNRA TQESVR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | C.cajan_21534 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT098495 | 2e-96 | BT098495.1 Soybean clone JCVI-FLGm-12F13 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020215002.1 | 8e-58 | GATA transcription factor 11 | ||||
| Refseq | XP_029127183.1 | 8e-58 | GATA transcription factor 11 | ||||
| Swissprot | Q9SV30 | 9e-41 | GATA8_ARATH; GATA transcription factor 8 | ||||
| TrEMBL | A0A151TNB6 | 2e-57 | A0A151TNB6_CAJCA; GATA transcription factor 10 | ||||
| STRING | GLYMA12G08131.1 | 5e-52 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF5758 | 28 | 49 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G54810.2 | 4e-43 | GATA family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




