PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

C.cajan_22489

Common Name

KK1_023091

Organism

Cajanus cajan

Taxonomic ID

3821

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus

Family

NAC

Protein Properties

Length: 172aa MW: 19662.3 Da PI: 10.3263

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
C.cajan_22489	genome	IIPG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	170.6	5e-53	26	153	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 l+pGfrFhPtdeelv +yLk+kv+gk++++ ++i+evdiy++eP dL +++k++++ewyfFs dkky +g r nrat +gyWkatg+d++v++ C.cajan_22489 26 LAPGFRFHPTDEELVIYYLKRKVSGKPFRF-DAISEVDIYRSEPGDLAdkSRLKTRDQEWYFFSALDKKYGNGGRMNRATGKGYWKATGNDRQVKH 120 579************************9.99**********75348899999********************************** PP NAM 95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++++vglkktLvf++grap+g++t+Wvmheyrl C.cajan_22489 121 -EERVVGLKKTLVFHSGRAPDGKRTNWVMHEYRL 153 .999**************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.09E-56	18	158	IPR003441	NAC domain
PROSITE profile	PS51005	52.293	26	172	IPR003441	NAC domain
Pfam	PF02365	1.1E-28	28	153	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 172 aa Download sequence Send to blast
MGRESVFLPT TASTTVNPVA APPTSLAPGF RFHPTDEELV IYYLKRKVSG KPFRFDAISE 60 VDIYRSEPGD LADKSRLKTR DQEWYFFSAL DKKYGNGGRM NRATGKGYWK ATGNDRQVKH 120 EERVVGLKKT LVFHSGRAPD GKRTNWVMHE YRLTEKEMER IGTGSSQPQV RF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3swm_A	4e-47	25	155	19	147	NAC domain-containing protein 19
3swm_B	4e-47	25	155	19	147	NAC domain-containing protein 19
3swm_C	4e-47	25	155	19	147	NAC domain-containing protein 19
3swm_D	4e-47	25	155	19	147	NAC domain-containing protein 19
3swp_A	4e-47	25	155	19	147	NAC domain-containing protein 19
3swp_B	4e-47	25	155	19	147	NAC domain-containing protein 19
3swp_C	4e-47	25	155	19	147	NAC domain-containing protein 19
3swp_D	4e-47	25	155	19	147	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC051/NAC052 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). {ECO:0000269\|PubMed:24045019, ECO:0000269\|PubMed:25578968, ECO:0000269\|PubMed:26617990}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	C.cajan_22489

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015041	3e-88	AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020222544.1	1e-125	NAC domain containing protein 50 isoform X2
Swissprot	Q9SQX9	5e-79	NAC50_ARATH; NAC domain containing protein 50
TrEMBL	A0A151T0U5	1e-121	A0A151T0U5_CAJCA; NAC domain-containing protein 78
TrEMBL	A0A151T164	1e-125	A0A151T164_CAJCA; NAC domain-containing protein 78
STRING	XP_004496131.1	2e-98	(Cicer arietinum)
STRING	XP_007144247.1	1e-100	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF8189	32	41

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G10490.1	3e-82	NAC domain containing protein 52

Publications ? help Back to Top
Zhang S, et al. C-terminal domains of a histone demethylase interact with a pair of transcription factors and mediate specific chromatin association. Cell Discov, 2019. [PMID:26617990]