![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | C.cajan_22493 | ||||||||
| Common Name | KK1_023155 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 128aa MW: 14041.1 Da PI: 7.2532 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 142.7 | 8.9e-45 | 1 | 78 | 17 | 94 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
mkk+lP n+ki+kdak+t+qecvsefisf+tseas+kcq+ekrktingddllwa+atlGfedy+eplkvyl++y+e +
C.cajan_22493 1 MKKALPPNGKIAKDAKDTMQECVSEFISFITSEASEKCQKEKRKTINGDDLLWAMATLGFEDYIEPLKVYLARYKEGD 78
9**************************************************************************965 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF00808 | 9.3E-23 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene3D | G3DSA:1.10.20.10 | 4.6E-42 | 1 | 81 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 4.35E-32 | 1 | 85 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 3.2E-21 | 19 | 37 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 22 | 38 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 3.2E-21 | 38 | 56 | No hit | No description |
| PRINTS | PR00615 | 3.2E-21 | 57 | 75 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 128 aa Download sequence Send to blast |
MKKALPPNGK IAKDAKDTMQ ECVSEFISFI TSEASEKCQK EKRKTINGDD LLWAMATLGF 60 EDYIEPLKVY LARYKEGDTK GSARSGDGSI RPDQVALAGQ NAQLVHQGSL NYIGLQVMVF 120 LSPSILNA |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 1e-37 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 1e-37 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | C.cajan_22493 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FJ775529 | 1e-115 | FJ775529.1 Glycine max CCAAT-binding transcription factor family protein (NF-YB1a) mRNA, complete cds. | |||
| GenBank | FJ775530 | 1e-115 | FJ775530.1 Glycine max CCAAT-binding transcription factor family protein (NF-YB1b) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020222188.1 | 4e-81 | nuclear transcription factor Y subunit B-1 | ||||
| Swissprot | Q9SLG0 | 1e-54 | NFYB1_ARATH; Nuclear transcription factor Y subunit B-1 | ||||
| TrEMBL | A0A151T105 | 1e-90 | A0A151T105_CAJCA; Nuclear transcription factor Y subunit B-1 | ||||
| STRING | GLYMA10G33550.2 | 2e-78 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2545 | 33 | 82 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38880.7 | 4e-59 | nuclear factor Y, subunit B1 | ||||




