![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | C.cajan_24447 | ||||||||
| Common Name | KK1_025663 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 95aa MW: 11622.3 Da PI: 11.8046 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 36.9 | 8e-12 | 2 | 55 | 11 | 64 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC CS
bZIP_1 11 qkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkseve 64
+NRe+ArrsR RK+ +e+L++ v + eN++L + l l ++ +l++e+e
C.cajan_24447 2 FSNRESARRSRMRKQRHLENLRNQVNLFRVENRELNNGLHFLLHHCNRLRTENE 55
69***********************************************99985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| CDD | cd14702 | 4.44E-10 | 1 | 48 | No hit | No description |
| PROSITE profile | PS50217 | 8.554 | 1 | 57 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 4.13E-10 | 1 | 48 | No hit | No description |
| Pfam | PF00170 | 1.9E-9 | 2 | 55 | IPR004827 | Basic-leucine zipper domain |
| SMART | SM00338 | 0.0015 | 3 | 56 | IPR004827 | Basic-leucine zipper domain |
| Gene3D | G3DSA:1.20.5.170 | 1.5E-6 | 3 | 52 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 95 aa Download sequence Send to blast |
MFSNRESARR SRMRKQRHLE NLRNQVNLFR VENRELNNGL HFLLHHCNRL RTENEWLRSQ 60 RTLLLQKLAN INQLLLFQQL QSFSSAWPCH ILETE |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 8 | 15 | RRSRMRKQ |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | C.cajan_24447 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015043 | 1e-85 | AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020230429.1 | 1e-61 | bZIP transcription factor 53 | ||||
| TrEMBL | A0A151SC60 | 2e-59 | A0A151SC60_CAJCA; G-box-binding factor 1 | ||||
| STRING | GLYMA11G04920.2 | 7e-48 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF5435 | 32 | 54 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G49760.1 | 2e-16 | basic leucine-zipper 5 | ||||




