![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | C.cajan_25279 | ||||||||
| Common Name | KK1_025329 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 149aa MW: 17594.2 Da PI: 10.0843 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 99.1 | 1.8e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krienk+nrqvtfskRr+g+lKKA+E+SvLCdaeva+i+fs++gkl+ey++
C.cajan_25279 9 KRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIVFSHKGKLFEYAT 59
79***********************************************86 PP
| |||||||
| 2 | K-box | 79.5 | 8.4e-27 | 75 | 144 | 1 | 70 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70
y++++ ++++++ + +++ e+++Lk++i+ Lqr++Rh++GedL+s+slkeLq+LeqqL+++lk+iR+++
C.cajan_25279 75 YAERQLVANDSESQGNWTIEYTRLKAKIDLLQRNHRHYMGEDLGSMSLKELQSLEQQLDTALKQIRTRRV 144
566778888889999****************************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 32.394 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 7.7E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.44E-34 | 2 | 92 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.06E-41 | 2 | 79 | No hit | No description |
| PRINTS | PR00404 | 1.3E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 3.1E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.3E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.3E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 2.5E-21 | 84 | 145 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 12.505 | 88 | 149 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009933 | Biological Process | meristem structural organization | ||||
| GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
| GO:0010582 | Biological Process | floral meristem determinacy | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 149 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FSKRRAGLLK KAHEISVLCD AEVALIVFSH KGKLFEYATD 60 SCMEKILERY ERYAYAERQL VANDSESQGN WTIEYTRLKA KIDLLQRNHR HYMGEDLGSM 120 SLKELQSLEQ QLDTALKQIR TRRVHKTYY |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 6e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_B | 6e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_C | 6e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_D | 6e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_A | 6e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_B | 6e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_C | 6e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_D | 6e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}. | |||||
| UniProt | Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00096 | ChIP-seq | Transfer from AT1G69120 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | C.cajan_25279 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB588744 | 0.0 | AB588744.1 Vigna unguiculata VuAP1 mRNA for APETALA1, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_014624024.1 | 1e-102 | truncated transcription factor CAULIFLOWER A isoform X2 | ||||
| Refseq | XP_028206840.1 | 1e-102 | truncated transcription factor CAULIFLOWER A-like isoform X2 | ||||
| Swissprot | D7KWY6 | 2e-86 | AP1_ARALL; Floral homeotic protein APETALA 1 | ||||
| Swissprot | Q6E6S7 | 2e-86 | AP1_VITVI; Agamous-like MADS-box protein AP1 | ||||
| TrEMBL | A0A151SD93 | 1e-105 | A0A151SD93_CAJCA; Floral homeotic protein APETALA 1 | ||||
| STRING | GLYMA16G13070.1 | 1e-100 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF588 | 32 | 119 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G69120.1 | 7e-80 | MIKC_MADS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




