![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | C.cajan_26154 | ||||||||
| Common Name | KK1_027154 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
| Family | WOX | ||||||||
| Protein Properties | Length: 99aa MW: 11769.3 Da PI: 11.3066 | ||||||||
| Description | WOX family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 63.4 | 3.3e-20 | 21 | 80 | 3 | 57 |
--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
Homeobox 3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
+R+++t+eql +Leel+++ r+psa+++++++++ +++ ++V++WFqN++a++++
C.cajan_26154 21 SRWSPTTEQLMILEELYKSgIRTPSASQIQQITTHFsfygRIEGKNVFYWFQNHKARDRQ 80
7*****************99*************************************996 PP
| |||||||
| 2 | Wus_type_Homeobox | 117.7 | 5.1e-38 | 20 | 81 | 3 | 64 |
Wus_type_Homeobox 3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
++RW+Pt+eQ++iLeelyksG+rtP++++iq+it++ + yG+ie+kNVfyWFQN+kaR+rqk
C.cajan_26154 20 SSRWSPTTEQLMILEELYKSGIRTPSASQIQQITTHFSFYGRIEGKNVFYWFQNHKARDRQK 81
79***********************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50071 | 10.074 | 16 | 81 | IPR001356 | Homeobox domain |
| SMART | SM00389 | 0.001 | 18 | 85 | IPR001356 | Homeobox domain |
| Pfam | PF00046 | 8.5E-18 | 21 | 80 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 1.63E-11 | 21 | 81 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 3.2E-8 | 21 | 80 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0008283 | Biological Process | cell proliferation | ||||
| GO:0009908 | Biological Process | flower development | ||||
| GO:0009943 | Biological Process | adaxial/abaxial axis specification | ||||
| GO:0009947 | Biological Process | centrolateral axis specification | ||||
| GO:0010865 | Biological Process | stipule development | ||||
| GO:0048513 | Biological Process | animal organ development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 99 aa Download sequence Send to blast |
FPVSRNSSHR ERNMSPATGS SRWSPTTEQL MILEELYKSG IRTPSASQIQ QITTHFSFYG 60 RIEGKNVFYW FQNHKARDRQ KLRRKLTKQL QLQQQQQVD |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in the lateral sepal axis-dependent development of flowers, probably by regulating the proliferation of L1 cells at the lateral region of flower primordia. Required for the formation of the margin cells of the first and second whorl organs. {ECO:0000269|PubMed:11751640, ECO:0000269|PubMed:15169755}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | C.cajan_26154 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015037 | 3e-99 | AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020240226.1 | 1e-47 | WUSCHEL-related homeobox 3 | ||||
| Swissprot | Q9SIB4 | 2e-39 | WOX3_ARATH; WUSCHEL-related homeobox 3 | ||||
| TrEMBL | A0A151S8F5 | 4e-67 | A0A151S8F5_CAJCA; WUSCHEL-related homeobox 3 (Fragment) | ||||
| STRING | GLYMA18G39520.2 | 2e-44 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF10632 | 29 | 40 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G28610.1 | 3e-35 | WOX family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




