![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | C.cajan_31328 | ||||||||
| Common Name | KK1_030481 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 127aa MW: 14790.2 Da PI: 6.8628 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 138.8 | 1.5e-43 | 46 | 122 | 2 | 78 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
Cqv+gC+adls+ak yhrrhkvCe h+kap+vl+++++qrfCqqCsrfhelsefD++krsCrrrLa+hnerrrk+++
C.cajan_31328 46 CQVDGCNADLSDAKPYHRRHKVCEYHAKAPAVLIADQHQRFCQQCSRFHELSEFDDSKRSCRRRLAGHNERRRKNAS 122
**************************************************************************875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PIRSF | PIRSF037575 | 2.1E-58 | 1 | 127 | IPR017238 | Squamosa promoter-binding protein |
| Gene3D | G3DSA:4.10.1100.10 | 5.7E-37 | 39 | 107 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 32.633 | 43 | 120 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 9.03E-40 | 44 | 124 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 1.2E-34 | 46 | 119 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009908 | Biological Process | flower development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 127 aa Download sequence Send to blast |
MNYKEEEEYE EEEEEESEGY GEDDRKKRVV TTKRGSKAGG SVPPSCQVDG CNADLSDAKP 60 YHRRHKVCEY HAKAPAVLIA DQHQRFCQQC SRFHELSEFD DSKRSCRRRL AGHNERRRKN 120 ASEYHGL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 2e-36 | 38 | 119 | 3 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | C.cajan_31328 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015038 | 4e-68 | AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020234618.1 | 8e-90 | squamosa promoter-binding protein 1 | ||||
| Swissprot | Q38741 | 2e-47 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
| TrEMBL | A0A151RZ83 | 4e-88 | A0A151RZ83_CAJCA; Squamosa promoter-binding protein 1 | ||||
| STRING | GLYMA13G31090.1 | 2e-71 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF535 | 34 | 153 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G33810.1 | 2e-40 | squamosa promoter binding protein-like 3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




