![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | C.cajan_32586 | ||||||||
| Common Name | KK1_033761 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
| Family | WOX | ||||||||
| Protein Properties | Length: 67aa MW: 8066.33 Da PI: 11.2242 | ||||||||
| Description | WOX family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 24.1 | 6.1e-08 | 22 | 48 | 31 | 57 |
HHHHHHCTS-HHHHHHHHHHHHHHHHC CS
Homeobox 31 eeLAkklgLterqVkvWFqNrRakekk 57
++L+ +++ ++ ++WFqN++ak+++
C.cajan_32586 22 THLSFYGKIQGKNLFYWFQNHKAKDRQ 48
5566666999***************96 PP
| |||||||
| 2 | Wus_type_Homeobox | 49 | 1.5e-16 | 17 | 49 | 32 | 64 |
Wus_type_Homeobox 32 iqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
i++ +++L+ yGki++kN fyWFQN+ka++rqk
C.cajan_32586 17 INNKKTHLSFYGKIQGKNLFYWFQNHKAKDRQK 49
5566799*************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF00046 | 1.9E-5 | 22 | 48 | IPR001356 | Homeobox domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 67 aa Download sequence Send to blast |
MITSIDNKHG KQKGILINNK KTHLSFYGKI QGKNLFYWFQ NHKAKDRQKL RRKLTNQLQL 60 QQQQQVD |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in the lateral sepal axis-dependent development of flowers, probably by regulating the proliferation of L1 cells at the lateral region of flower primordia. Required for the formation of the margin cells of the first and second whorl organs. {ECO:0000269|PubMed:11751640, ECO:0000269|PubMed:15169755}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | C.cajan_32586 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022756585.1 | 2e-17 | WUSCHEL-related homeobox 3-like | ||||
| Swissprot | Q9SIB4 | 2e-14 | WOX3_ARATH; WUSCHEL-related homeobox 3 | ||||
| TrEMBL | A0A151RQ84 | 1e-39 | A0A151RQ84_CAJCA; WUSCHEL-related homeobox 3 | ||||
| STRING | XP_004148244.1 | 1e-15 | (Cucumis sativus) | ||||
| STRING | XP_004168470.1 | 1e-15 | (Cucumis sativus) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF10632 | 29 | 40 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G28610.1 | 2e-17 | WOX family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




