![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | C.cajan_36783 | ||||||||
| Common Name | KK1_040686 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 84aa MW: 9729.3 Da PI: 10.7051 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 102.5 | 1.5e-32 | 25 | 75 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey++
C.cajan_36783 25 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN 75
79***********************************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.1E-42 | 17 | 76 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.57E-30 | 17 | 77 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 33.992 | 17 | 77 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 7.23E-40 | 18 | 76 | No hit | No description |
| PRINTS | PR00404 | 5.2E-34 | 19 | 39 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 19 | 73 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 9.6E-28 | 26 | 73 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.2E-34 | 39 | 54 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.2E-34 | 54 | 75 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 84 aa Download sequence Send to blast |
MAFPNQSMSS VSPQRKMGRG KIEIKRIENT TNRQVTFCKR RNGLLKKAYE LSVLCDAEVA 60 LIVFSSRGRL YEYANNRYLL FFSS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 5e-22 | 17 | 83 | 1 | 70 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 5e-22 | 17 | 83 | 1 | 70 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 5e-22 | 17 | 83 | 1 | 70 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 5e-22 | 17 | 83 | 1 | 70 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 5e-22 | 17 | 83 | 1 | 70 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 5e-22 | 17 | 83 | 1 | 70 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 5e-22 | 17 | 83 | 1 | 70 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 5e-22 | 17 | 83 | 1 | 70 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 5e-22 | 17 | 83 | 1 | 70 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 5e-22 | 17 | 83 | 1 | 70 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}. | |||||
| UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}. | |||||
| UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | C.cajan_36783 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015034 | 1e-107 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020204254.1 | 2e-49 | floral homeotic protein AGAMOUS | ||||
| Swissprot | Q40872 | 7e-42 | AG_PANGI; Floral homeotic protein AGAMOUS | ||||
| Swissprot | Q40885 | 8e-42 | AG_PETHY; Floral homeotic protein AGAMOUS | ||||
| Swissprot | Q43585 | 8e-42 | AG_TOBAC; Floral homeotic protein AGAMOUS | ||||
| TrEMBL | A0A151R633 | 7e-55 | A0A151R633_CAJCA; Floral homeotic protein AGAMOUS | ||||
| STRING | GLYMA08G12730.2 | 3e-46 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF119 | 33 | 360 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G58780.2 | 7e-41 | MIKC_MADS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




