PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

C.cajan_39715

Common Name

KK1_038881

Organism

Cajanus cajan

Taxonomic ID

3821

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus

Family

MYB_related

Protein Properties

Length: 68aa MW: 7857.19 Da PI: 10.5472

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
C.cajan_39715	genome	IIPG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	49.3	1.1e-15	15	61	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+WT+ Ed +lv +++++G+g+W++I+ g+ + k+c++rw ++ C.cajan_39715 15 KGPWTPKEDIILVSYIQEHGPGNWRSIPTNTGLMTCSKSCRLRWTNH 61 79****************************999*******997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	3.6E-18	6	64	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.72E-14	9	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	19.871	10	66	IPR017930	Myb domain
SMART	SM00717	2.2E-8	14	64	IPR001005	SANT/Myb domain
Pfam	PF00249	2.3E-14	15	61	IPR001005	SANT/Myb domain
CDD	cd00167	1.07E-9	17	61	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 68 aa Download sequence Send to blast
MIGRPPCYDK IGIKKGPWTP KEDIILVSYI QEHGPGNWRS IPTNTGLMTC SKSCRLRWTN 60 HPRHQKVK

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light). {ECO:0000269\|PubMed:22018045}.
UniProt	Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light) (PubMed:16005291, PubMed:21637967). Promotes guard cell deflation in response to water deficit. Triggers root growth upon osmotic stress (e.g. mannitol containing medium) (PubMed:21637967). {ECO:0000269\|PubMed:16005291, ECO:0000269\|PubMed:21637967}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	C.cajan_39715

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by jasmonic acid (JA) and salicylic acid (SA) (PubMed:16463103). Triggered by auxin (IAA) in roots (PubMed:9839469, PubMed:21637967). Stimulated by light, UV-light and cold (PubMed:9839469). According to PubMed:16005291 and PubMed:23828545, rapidly repressed by abscisic acid (ABA) in an ABI1-dependent manner. But in contrast, according to PubMed:21637967, transiently induced by ABA in seedlings (PubMed:16005291, PubMed:21637967, PubMed:23828545). Rapidly repressed by drought. Activated by white light, but repressed by blue light and darkness (PubMed:16005291). Transiently induced by salt (NaCl) in seedlings. Induced by sucrose (PubMed:21637967). Positively regulated by SCAP1 (PubMed:23453954). {ECO:0000269\|PubMed:16005291, ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:21637967, ECO:0000269\|PubMed:23453954, ECO:0000269\|PubMed:23828545, ECO:0000269\|PubMed:9839469}.
UniProt	INDUCTION: Repressed by abscisic acid (ABA) and osmotic stress (salt stress). {ECO:0000269\|PubMed:22018045}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT095719	2e-46	BT095719.1 Soybean clone JCVI-FLGm-19D22 unknown mRNA.
GenBank	KC759158	2e-46	KC759158.1 Glycine max transcription factor MYBJ2 (MYBJ2) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006482590.1	1e-35	myb-related protein 306-like
Swissprot	B3VTV7	1e-34	MYB60_VITVI; Transcription factor MYB60
Swissprot	Q8GYP5	7e-35	MYB60_ARATH; Transcription factor MYB60
TrEMBL	A0A151RBD5	3e-43	A0A151RBD5_CAJCA; Myb-related protein 306 family
STRING	XP_006482590.1	4e-35	(Citrus sinensis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G08810.1	3e-37	myb domain protein 60

Publications ? help Back to Top
Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Galbiati M, et al. Gene trap lines identify Arabidopsis genes expressed in stomatal guard cells. Plant J., 2008. 53(5): p. 750-62 [PMID:18036199] Rusconi F, et al. The Arabidopsis thaliana MYB60 promoter provides a tool for the spatio-temporal control of gene expression in stomatal guard cells. J. Exp. Bot., 2013. 64(11): p. 3361-71 [PMID:23828545] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Kim D,Ntui VO,Xiong L Arabidopsis YAK1 regulates abscisic acid response and drought resistance. FEBS Lett., 2016. 590(14): p. 2201-9 [PMID:27264339]