![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | C.cajan_40825 | ||||||||
| Common Name | KK1_042251 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 80aa MW: 9447.17 Da PI: 11.7957 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 57.8 | 1.5e-18 | 17 | 51 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
Cs+C++++Tp+WR gp g tLCnaCG++y++ +l
C.cajan_40825 17 CSHCNVKETPQWRVGPLGRNTLCNACGMRYKSGRL 51
*******************************9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00401 | 2.0E-13 | 11 | 61 | IPR000679 | Zinc finger, GATA-type |
| PROSITE profile | PS50114 | 11.78 | 11 | 47 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 1.2E-14 | 14 | 49 | IPR013088 | Zinc finger, NHR/GATA-type |
| SuperFamily | SSF57716 | 7.6E-15 | 14 | 73 | No hit | No description |
| CDD | cd00202 | 1.92E-12 | 16 | 65 | No hit | No description |
| Pfam | PF00320 | 2.1E-16 | 17 | 51 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 80 aa Download sequence Send to blast |
MKRKRRCKKR TYSKRRCSHC NVKETPQWRV GPLGRNTLCN ACGMRYKSGR LLPEYRPASS 60 PTFNVNKHSN VHKKILIMRS |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 1 | 15 | KRKRRCKKRTYSKRR |
| 2 | 4 | 10 | RRCKKRT |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | C.cajan_40825 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020205415.1 | 5e-53 | putative GATA transcription factor 13 | ||||
| Swissprot | O82632 | 3e-30 | GATA9_ARATH; GATA transcription factor 9 | ||||
| TrEMBL | A0A151R1Y9 | 2e-51 | A0A151R1Y9_CAJCA; GATA transcription factor 11 | ||||
| STRING | GLYMA01G10390.1 | 7e-32 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF16347 | 7 | 9 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G32890.1 | 1e-32 | GATA transcription factor 9 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




