PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

C.cajan_42337

Common Name

KK1_046389

Organism

Cajanus cajan

Taxonomic ID

3821

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus

Family

MYB_related

Protein Properties

Length: 73aa MW: 8535.78 Da PI: 7.2544

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
C.cajan_42337	genome	IIPG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	47.4	4.3e-15	1	40	8	48
HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 Ed l+++vk++G ++W+ I+++++ gR +kqc++rw+++l C.cajan_42337 1 EDACLIELVKKYGIKRWSIISKYLP-GRIGKQCRERWNNHL 40 8999*******************.***********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
CDD	cd00167	1.28E-12	1	40	No hit	No description
Pfam	PF13921	2.0E-15	1	56	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.6E-25	1	58	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.69E-18	1	58	IPR009057	Homeodomain-like
PROSITE profile	PS51294	26.565	1	44	IPR017930	Myb domain
SMART	SM00717	1.4E-8	1	42	IPR001005	SANT/Myb domain
PROSITE profile	PS50090	4.101	41	60	IPR017877	Myb-like domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 73 aa Download sequence Send to blast
EDACLIELVK KYGIKRWSII SKYLPGRIGK QCRERWNNHL DPTIKKDAWT EEEEKYLLSV 60 TNTTPEVAID STI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	5e-23	1	60	14	73	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in abiotic stress responses (PubMed:17293435, PubMed:19279197). May play a regulatory role in tolerance to salt, cold, and drought stresses (PubMed:17293435). Transcriptional activator that binds specifically to a mitosis-specific activator cis-element 5'-(T/C)C(T/C)AACGG(T/C)(T/C)A-3', found in promoters of cyclin genes such as CYCB1-1 and KNOLLE (AC Q84R43). Positively regulates a subset of G2/M phase-specific genes, including CYCB1-1, CYCB2-1, CYCB2-2, and CDC20.1 in response to cold treatment (PubMed:19279197). {ECO:0000269\|PubMed:17293435, ECO:0000269\|PubMed:19279197}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	C.cajan_42337

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by cold, drought and salt stresses. {ECO:0000269\|PubMed:17293435}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020208100.1	6e-51	chitinase-like protein PB1E7.04c isoform X2
Swissprot	Q0JHU7	4e-23	MB3R2_ORYSJ; Transcription factor MYB3R-2
TrEMBL	A0A151QRE4	4e-46	A0A151QRE4_CAJCA; Uncharacterized protein (Fragment)
STRING	GLYMA01G42650.1	6e-25	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1570	31	96

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G02320.2	4e-25	myb domain protein 3r-5

Publications ? help Back to Top
Kakar KU, et al. A consortium of rhizobacterial strains and biochemical growth elicitors improve cold and drought stress tolerance in rice (Oryza sativa L.). Plant Biol (Stuttg), 2016. 18(3): p. 471-83 [PMID:26681628]