PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

C.cajan_43528

Common Name

KK1_012372

Organism

Cajanus cajan

Taxonomic ID

3821

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus

Family

Protein Properties

Length: 65aa MW: 7806.06 Da PI: 10.5355

Description

B3 family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
C.cajan_43528	genome	IIPG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	B3	55.1	1.3e-17	6	58	31	83
.--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS B3 31 eesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83 + s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F C.cajan_43528 6 RPSQELVAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVNQKNLVSGDAVLFL 58 44679**********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50863	11.589	1	65	IPR003340	B3 DNA binding domain
SuperFamily	SSF101936	1.01E-21	1	60	IPR015300	DNA-binding pseudobarrel domain
Gene3D	G3DSA:2.40.330.10	6.1E-21	2	59	IPR015300	DNA-binding pseudobarrel domain
Pfam	PF02362	2.9E-15	5	58	IPR003340	B3 DNA binding domain
CDD	cd10017	6.51E-12	6	57	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 65 aa Download sequence Send to blast
DYKQQRPSQE LVAKDLHGVE WKFRHIYRGQ PRRHLLTTGW SIFVNQKNLV SGDAVLFLRC 60 VYMFK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4ldv_A	2e-25	1	59	154	212	Auxin response factor 1
4ldw_A	2e-25	1	59	154	212	Auxin response factor 1
4ldw_B	2e-25	1	59	154	212	Auxin response factor 1
4ldx_A	1e-25	1	59	154	212	Auxin response factor 1
4ldx_B	1e-25	1	59	154	212	Auxin response factor 1
4ldy_A	2e-25	1	59	154	212	Auxin response factor 1
4ldy_B	2e-25	1	59	154	212	Auxin response factor 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269\|PubMed:12036261}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	C.cajan_43528

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	FJ617271	2e-53	FJ617271.1 Lotus japonicus auxin response factor 4 (ARF4) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009592534.1	8e-37	PREDICTED: auxin response factor 4-like
Refseq	XP_029126027.1	6e-37	auxin response factor 4
Refseq	XP_029127060.1	6e-37	auxin response factor 4
Refseq	XP_029127762.1	6e-37	auxin response factor 4-like
Swissprot	Q9ZTX9	2e-36	ARFD_ARATH; Auxin response factor 4
TrEMBL	A0A151TGC4	4e-42	A0A151TGC4_CAJCA; Transcription factor bHLH63
STRING	GLYMA12G07560.1	3e-35	(Glycine max)
STRING	XP_009592534.1	3e-36	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF15884	6	10

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60450.1	8e-39	auxin response factor 4

Publications ? help Back to Top
Ozerova LV,Krasnikova MS,Troitsky AV,Solovyev AG,Morozov SY TAS3 Genes for small ta-siARF RNAs in plants belonging to subtribe Senecioninae: occurrence of prematurely terminated RNA precursors. Mol. Gen. Mikrobiol. Virusol., 2013. [PMID:24003511] Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis. Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71 [PMID:26108442] Pashkovskiy PP,Kartashov AV,Zlobin IE,Pogosyan SI,Kuznetsov VV Blue light alters miR167 expression and microRNA-targeted auxin response factor genes in Arabidopsis thaliana plants. Plant Physiol. Biochem., 2016. 104: p. 146-54 [PMID:27031426] Matsumura Y, et al. A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis. Biol Open, 2016. 5(7): p. 942-54 [PMID:27334696] Guan C, et al. Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis. Curr. Biol., 2017. 27(19): p. 2940-2950.e4 [PMID:28943086] Liu Z, et al. ARF2-ARF4 and ARF5 are Essential for Female and Male Gametophyte Development in Arabidopsis. Plant Cell Physiol., 2018. 59(1): p. 179-189 [PMID:29145642]