![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | C.cajan_46239 | ||||||||
| Common Name | KK1_049115 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
| Family | B3 | ||||||||
| Protein Properties | Length: 69aa MW: 7987.18 Da PI: 5.4552 | ||||||||
| Description | B3 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | B3 | 40.4 | 5.4e-13 | 5 | 62 | 41 | 98 |
TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
B3 41 esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
+ + W vk+ + ++ + +++ GW +F+++n+L+ gD+++F+l++ +++ l ++vfr
C.cajan_46239 5 FRKNLWPVKFAFHSSGVSGMFSVGWHSFARENELQIGDVCIFELVNGEDGILDLHVFR 62
56788*****9999999999************************98899999999998 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50863 | 12.717 | 1 | 64 | IPR003340 | B3 DNA binding domain |
| SuperFamily | SSF101936 | 9.02E-13 | 6 | 62 | IPR015300 | DNA-binding pseudobarrel domain |
| Gene3D | G3DSA:2.40.330.10 | 1.0E-12 | 6 | 65 | IPR015300 | DNA-binding pseudobarrel domain |
| Pfam | PF02362 | 1.6E-10 | 7 | 62 | IPR003340 | B3 DNA binding domain |
| CDD | cd10017 | 5.01E-12 | 8 | 62 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 69 aa Download sequence Send to blast |
MMIQFRKNLW PVKFAFHSSG VSGMFSVGWH SFARENELQI GDVCIFELVN GEDGILDLHV 60 FRDQCEVMH |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | C.cajan_46239 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020209298.1 | 5e-43 | B3 domain-containing transcription factor VRN1 isoform X1 | ||||
| Refseq | XP_020209299.1 | 5e-43 | B3 domain-containing transcription factor VRN1 isoform X2 | ||||
| TrEMBL | A0A151UI03 | 7e-44 | A0A151UI03_CAJCA; B3 domain-containing transcription factor VRN1 | ||||
| STRING | GLYMA09G20150.1 | 1e-21 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF98 | 34 | 369 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G18990.1 | 1e-10 | B3 family protein | ||||




