PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

C.cajan_46629

Common Name

KK1_048807

Organism

Cajanus cajan

Taxonomic ID

3821

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus

Family

LBD

Protein Properties

Length: 99aa MW: 10883.5 Da PI: 6.7896

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
C.cajan_46629	genome	IIPG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	57.5	3.9e-18	4	74	29	100
DUF260 29 kfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100 +a++ lF+ +n+ +ll++l+ +red+++sl+yeAear+ dP+yG+vg+i+ lq++l+ql++el+++k+e C.cajan_46629 4 PYAILPNLFSSANL-NLLNELNAAQREDTVKSLAYEAEARLWDPMYGCVGLISILQHRLKQLQTELNHAKSE 74 56777889998885.89**************************************************99987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	11.157	1	75	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	3.3E-16	5	72	IPR004883	Lateral organ boundaries, LOB

Sequence ? help Back to Top
Protein Sequence Length: 99 aa Download sequence Send to blast
EKKPYAILPN LFSSANLNLL NELNAAQRED TVKSLAYEAE ARLWDPMYGC VGLISILQHR 60 LKQLQTELNH AKSELASDIG PHALLPPTPS PPPPPPPKP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	3e-20	1	75	36	111	LOB family transfactor Ramosa2.1
5ly0_B	3e-20	1	75	36	111	LOB family transfactor Ramosa2.1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Controls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269\|PubMed:12787254, ECO:0000269\|PubMed:15821980}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	C.cajan_46629

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_029126320.1	8e-66	LOB domain-containing protein 18
Swissprot	Q9FKZ3	2e-28	LBD36_ARATH; LOB domain-containing protein 36
TrEMBL	A0A151UDL2	3e-64	A0A151UDL2_CAJCA; LOB domain-containing protein 36 (Fragment)
STRING	XP_007136211.1	1e-35	(Phaseolus vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G66870.1	4e-23	ASYMMETRIC LEAVES 2-like 1

Publications ? help Back to Top
Kim M,Kim MJ,Pandey S,Kim J Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development. Plant Cell Physiol., 2016. 57(11): p. 2291-2299 [PMID:27519310] Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana. Plant Mol. Biol., 2016. 92(6): p. 661-674 [PMID:27605094]