PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

CA00g44640

Organism

Capsicum annuum

Taxonomic ID

4072

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum

Family

M-type_MADS

Protein Properties

Length: 78aa MW: 8869.43 Da PI: 10.2791

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
CA00g44640	genome	PEP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	101.6	2.9e-32	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 kri+nk+nrqvtf+kRrng+lKKA+ELSvLCdae+a+iifss+gklye++s CA00g44640 9 KRIDNKINRQVTFAKRRNGLLKKAYELSVLCDAEIALIIFSSRGKLYEFCS 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	33.291	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	6.0E-42	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	3.53E-31	2	65	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.21E-38	2	61	No hit	No description
PRINTS	PR00404	1.2E-33	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.9E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-33	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-33	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 78 aa Download sequence Send to blast
MGRGKVELKR IDNKINRQVT FAKRRNGLLK KAYELSVLCD AEIALIIFSS RGKLYEFCSS 60 SRYVCIFIIS HFYSSSV*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6bz1_A	4e-21	1	61	1	61	MEF2 CHIMERA
6bz1_B	4e-21	1	61	1	61	MEF2 CHIMERA
6bz1_C	4e-21	1	61	1	61	MEF2 CHIMERA
6bz1_D	4e-21	1	61	1	61	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor active in inflorescence development and floral organogenesis.
UniProt	Probable transcription factor involved in flower development. {ECO:0000250\|UniProtKB:Q0HA25}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JX402926	5e-97	JX402926.1 Capsicum annuum MADS-box transcription factor MADS-RIN mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016547230.1	1e-36	PREDICTED: MADS-box protein CMB1-like
Swissprot	O04067	6e-36	AGL9_SINAL; Agamous-like MADS-box protein AGL9 homolog
Swissprot	Q8LLR0	6e-36	MADS4_VITVI; Agamous-like MADS-box protein MADS4
TrEMBL	A0A2G2YQH6	3e-46	A0A2G2YQH6_CAPAN; Uncharacterized protein
STRING	Lus10011349	2e-36	(Linum usitatissimum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G03710.3	8e-38	MIKC_MADS family protein

Publications ? help Back to Top
Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ Genome-wide analysis of MIKCC-type MADS box genes in grapevine. Plant Physiol., 2009. 149(1): p. 354-69 [PMID:18997115] Grimplet J,Martínez-Zapater JM,Carmona MJ Structural and functional annotation of the MADS-box transcription factor family in grapevine. BMC Genomics, 2016. 17: p. 80 [PMID:26818751] Bonhomme F,Sommer H,Bernier G,Jacqmard A Characterization of SaMADS D from Sinapis alba suggests a dual function of the gene: in inflorescence development and floral organogenesis. Plant Mol. Biol., 1997. 34(4): p. 573-82 [PMID:9247539]