![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | CA00g73380 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 125aa MW: 14506 Da PI: 11.9067 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 86.4 | 4.1e-27 | 20 | 74 | 3 | 58 |
CBFB_NFYA 3 plYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
p+YVNaKQy++IlkRRq ak ++++kl +k+rkpylh+SRh+hA++R Rg gG F
CA00g73380 20 PIYVNAKQYSAILKRRQVHAKRQDQNKL-IKNRKPYLHKSRHRHAMKRSRGFGGCF 74
9***************************.*************************87 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 2.1E-28 | 16 | 77 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 30.768 | 17 | 77 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 8.2E-23 | 20 | 74 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 5.7E-20 | 20 | 42 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 5.7E-20 | 51 | 74 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 125 aa Download sequence Send to blast |
MVGVTTIRVA LPLECIEIFP IYVNAKQYSA ILKRRQVHAK RQDQNKLIKN RKPYLHKSRH 60 RHAMKRSRGF GGCFLNTKNM QQSKPSSPKH DRNIFNHQAG VLALAIRDSL TIHPWILRGD 120 RRTW* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 7e-18 | 20 | 79 | 4 | 63 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 58 | 67 | RHRHAMKRSR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KJ865409 | 1e-122 | KJ865409.1 Capsicum annuum cultivar CMS line FS4401 mitochondrion, complete genome. | |||
| GenBank | KJ865410 | 1e-122 | KJ865410.1 Capsicum annuum cultivar Jeju mitochondrion, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | YP_009049690.1 | 2e-56 | hypothetical protein (mitochondrion) | ||||
| Swissprot | Q9LNP6 | 7e-27 | NFYA8_ARATH; Nuclear transcription factor Y subunit A-8 | ||||
| TrEMBL | A0A2G2Y6Y1 | 7e-88 | A0A2G2Y6Y1_CAPAN; Uncharacterized protein | ||||
| STRING | PGSC0003DMT400055982 | 2e-53 | (Solanum tuberosum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA4800 | 20 | 27 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G17590.4 | 3e-29 | nuclear factor Y, subunit A8 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




