PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

CA02g08630

Organism

Capsicum annuum

Taxonomic ID

4072

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum

Family

ZF-HD

Protein Properties

Length: 81aa MW: 8847.59 Da PI: 8.904

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
CA02g08630	genome	PEP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	62.3	9.8e-20	29	64	3	38
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegta 38 +vrYkeC+kNhAas+Gg+avDGC+Efmps +e +++ CA02g08630 29 RVRYKECQKNHAASVGGYAVDGCREFMPSGDEGTDS 64 79**************************95554554 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	1.0E-12	1	62	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	2.9E-17	30	64	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	1.4E-15	31	63	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	17.63	32	80	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 81 aa Download sequence Send to blast
MRKIQVVVKR DDDSASSQSS TNSAFTVRRV RYKECQKNHA ASVGGYAVDG CREFMPSGDE 60 GTDSXCLWLS PQFPPKRSGN *

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016559051.1	4e-40	PREDICTED: mini zinc finger protein 2
Swissprot	Q9LJW5	7e-18	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	A0A2G3A600	4e-52	A0A2G3A600_CAPAN; Mini zinc finger protein 2
STRING	Solyc02g067330.1.1	2e-29	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1105	24	86

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	1e-18	mini zinc finger 2

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]