PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

CA03g24050

Organism

Capsicum annuum

Taxonomic ID

4072

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum

Family

M-type_MADS

Protein Properties

Length: 62aa MW: 6900.98 Da PI: 10.3869

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
CA03g24050	genome	PEP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	91.8	3.3e-29	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqv+fskRr g+lKKA+ELS+LCdaeva+++fs++gk y ++s CA03g24050 9 KRIENQTNRQVSFSKRRSGLLKKAYELSILCDAEVALLLFSPSGKAYQFAS 59 79***********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	32.029	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	3.8E-39	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.06E-35	2	59	No hit	No description
SuperFamily	SSF55455	9.29E-29	2	60	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.2E-31	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.7E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.2E-31	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.2E-31	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 62 aa Download sequence Send to blast
MGRGKVELKR IENQTNRQVS FSKRRSGLLK KAYELSILCD AEVALLLFSP SGKAYQFASH 60 E*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	8e-22	1	61	1	61	MEF2 CHIMERA
6byy_B	8e-22	1	61	1	61	MEF2 CHIMERA
6byy_C	8e-22	1	61	1	61	MEF2 CHIMERA
6byy_D	8e-22	1	61	1	61	MEF2 CHIMERA
6bz1_A	8e-22	1	61	1	61	MEF2 CHIMERA
6bz1_B	8e-22	1	61	1	61	MEF2 CHIMERA
6bz1_C	8e-22	1	61	1	61	MEF2 CHIMERA
6bz1_D	8e-22	1	61	1	61	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	MADS-box transcription factor that acts redundantly with EJ2 to control meristem maturation and inflorescence architecture. {ECO:0000269\|PubMed:28528644}.
UniProt	Probable transcription factor (Probable). Is required, together with TT16/AGL32 for the maternal control of endothelium formation, which is essential for female gametophyte development and fertilization, and seed formation (PubMed:22176531). {ECO:0000269\|PubMed:22176531, ECO:0000305}.
UniProt	Probable transcription factor. Regulates floral organ identity and floral meristem determinacy. May be involved in the control of flowering time. {ECO:0000269\|PubMed:19820190, ECO:0000269\|Ref.8}.
UniProt	Probable transcription factor that binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:7632923, PubMed:25183521). Plays an important role in the determination of flower meristem identity. Involved in the specification of sepal identity. Contributes to the development of petals, stamens and carpels (PubMed:15530395). {ECO:0000269\|PubMed:15530395, ECO:0000269\|PubMed:25183521, ECO:0000269\|PubMed:7632923}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HG975442	3e-61	HG975442.1 Solanum pennellii chromosome ch03, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016563911.1	1e-36	PREDICTED: MADS-box transcription factor 6-like isoform X1
Refseq	XP_016563912.1	1e-36	PREDICTED: agamous-like MADS-box protein AGL5 isoform X2
Refseq	XP_016563913.1	8e-37	PREDICTED: MADS-box transcription factor 6-like isoform X3
Swissprot	K4DEK0	4e-27	J2_SOLLC; MADS-box protein J2
Swissprot	P29383	5e-27	AGL3_ARATH; Agamous-like MADS-box protein AGL3
Swissprot	Q38836	4e-27	AGL11_ARATH; Agamous-like MADS-box protein AGL11
Swissprot	Q6EU39	4e-27	MADS6_ORYSJ; MADS-box transcription factor 6
TrEMBL	A0A2G3BFF1	8e-36	A0A2G3BFF1_CAPCH; Agamous-like MADS-box protein AGL11 (Fragment)
STRING	Solyc03g019710.2.1	2e-34	(Solanum lycopersicum)
STRING	PGSC0003DMT400039313	2e-34	(Solanum tuberosum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G03710.3	3e-30	MIKC_MADS family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Li H, et al. The AGL6-like gene OsMADS6 regulates floral organ and meristem identities in rice. Cell Res., 2010. 20(3): p. 299-313 [PMID:20038961] Zhang J,Nallamilli BR,Mujahid H,Peng Z OsMADS6 plays an essential role in endosperm nutrient accumulation and is subject to epigenetic regulation in rice (Oryza sativa). Plant J., 2010. 64(4): p. 604-17 [PMID:20822505] Seok HY, et al. Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Yadav SR,Khanday I,Majhi BB,Veluthambi K,Vijayraghavan U Auxin-responsive OsMGH3, a common downstream target of OsMADS1 and OsMADS6, controls rice floret fertility. Plant Cell Physiol., 2011. 52(12): p. 2123-35 [PMID:22016342] Tomato Genome Consortium The tomato genome sequence provides insights into fleshy fruit evolution. Nature, 2012. 485(7400): p. 635-41 [PMID:22660326] Duan Y, et al. Characterization of Osmads6-5, a null allele, reveals that OsMADS6 is a critical regulator for early flower development in rice (Oryza sativa L.). Plant Mol. Biol., 2012. 80(4-5): p. 429-42 [PMID:22933119] Conrad LJ, et al. The polycomb group gene EMF2B is essential for maintenance of floral meristem determinacy in rice. Plant J., 2014. 80(5): p. 883-94 [PMID:25279942] Zhang J, et al. Down-regulation of a LBD-like gene, OsIG1, leads to occurrence of unusual double ovules and developmental abnormalities of various floral organs and megagametophyte in rice. J. Exp. Bot., 2015. 66(1): p. 99-112 [PMID:25324400] Maejima K, et al. Degradation of class E MADS-domain transcription factors in Arabidopsis by a phytoplasmal effector, phyllogen. Plant Signal Behav, 2015. 10(8): p. e1042635 [PMID:26179462] Bai X, et al. Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice. Sci Rep, 2016. 6: p. 19022 [PMID:26744119] Zhang B, et al. A High Temperature-Dependent Mitochondrial Lipase EXTRA GLUME1 Promotes Floral Phenotypic Robustness against Temperature Fluctuation in Rice (Oryza sativa L.). PLoS Genet., 2016. 12(7): p. e1006152 [PMID:27367609] Ezquer I, et al. The Developmental Regulator SEEDSTICK Controls Structural and Mechanical Properties of the Arabidopsis Seed Coat. Plant Cell, 2016. 28(10): p. 2478-2492 [PMID:27624758] Soyk S, et al. Bypassing Negative Epistasis on Yield in Tomato Imposed by a Domestication Gene. Cell, 2017. 169(6): p. 1142-1155.e12 [PMID:28528644]