![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | CA03g24070 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 57aa MW: 6811.76 Da PI: 4.4352 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 38 | 3.5e-12 | 1 | 45 | 56 | 100 |
NF-YC 56 leltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprde 100
+e+ + sw h e++k rtl+k+di+ a+ +dif f+ divp e
CA03g24070 1 MEFNVHSWFHVENKKYRTLQKNDISGAIRWSDIFYFICDIVPIYE 45
68899************************************9765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 4.2E-6 | 6 | 42 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 5.58E-6 | 6 | 51 | IPR009072 | Histone-fold |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 57 aa Download sequence Send to blast |
MEFNVHSWFH VENKKYRTLQ KNDISGAIRW SDIFYFICDI VPIYEINEEA MVVELE* |
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016566807.1 | 4e-19 | PREDICTED: nuclear transcription factor Y subunit C-4-like | ||||
| TrEMBL | A0A2G3A0Y5 | 1e-33 | A0A2G3A0Y5_CAPAN; Uncharacterized protein | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G48590.1 | 9e-16 | nuclear factor Y, subunit C1 | ||||




