PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

CA03g25470

Organism

Capsicum annuum

Taxonomic ID

4072

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum

Family

MYB_related

Protein Properties

Length: 111aa MW: 13029.7 Da PI: 11.0224

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
CA03g25470	genome	PEP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	29.7	1.5e-09	2	43	6	47
HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +eE++l++ + ++ G+++W+ I+r + k+R + q+ s+ qky CA03g25470 2 EEEHKLFLLGLHKVGKEDWREISRNFVKTRAPTQVASHGQKY 43 7*************************************9999 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	11.069	1	48	IPR017930	Myb domain
TIGRFAMs	TIGR01557	2.1E-11	2	46	IPR006447	Myb domain, plants
Pfam	PF00249	7.8E-7	2	43	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	2.15E-10	2	48	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	3.0E-6	2	39	IPR009057	Homeodomain-like
CDD	cd00167	9.66E-5	2	44	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 111 aa Download sequence Send to blast
MEEEHKLFLL GLHKVGKEDW REISRNFVKT RAPTQVASHG QKYFLRRTNP NPLXSHFDIT 60 TDSVYHSNPK IPSVNIRHRL HSSVRRQSKN NKFNLNFSEL AYLILVRILF *

Functional Description ? help Back to Top
Source	Description
UniProt	Binds selectively to the DNA sequence 5'-[GA]GATAA-3' and may act as a transcription factor involved in the regulation of drought-responsive genes. Enhances stomatal closure in response to abscisic acid (ABA). Confers drought and salt tolerance. {ECO:0000269\|PubMed:21030505}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by drought, high salinity, and ABA. {ECO:0000269\|PubMed:21030505}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007153882.1	3e-23	hypothetical protein PHAVU_003G072800g
Refseq	XP_016169474.1	3e-23	LOW QUALITY PROTEIN: transcription factor MYB1R1-like
Refseq	XP_016202602.1	3e-23	transcription factor MYB1R1
Refseq	XP_025654458.1	3e-23	transcription factor MYB1R1
Swissprot	Q2V9B0	1e-21	MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBL	A0A2G2ZZK5	3e-74	A0A2G2ZZK5_CAPAN; Uncharacterized protein
STRING	GLYMA02G03020.1	3e-22	(Glycine max)
STRING	XP_007153882.1	1e-22	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA7454	12	30

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G70000.2	5e-24	MYB_related family protein

Publications ? help Back to Top
Shin D, et al. Expression of StMYB1R-1, a novel potato single MYB-like domain transcription factor, increases drought tolerance. Plant Physiol., 2011. 155(1): p. 421-32 [PMID:21030505]