![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | CA03g26510 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
| Family | TALE | ||||||||
| Protein Properties | Length: 109aa MW: 13047 Da PI: 10.4738 | ||||||||
| Description | TALE family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 26.6 | 1e-08 | 53 | 87 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55
+ +yp++ ++ LA+++gL+ +q+ +WF N+R ++
CA03g26510 53 NWPYPTEVDKVFLAESTGLDPKQINNWFINQRKRH 87
569*****************************985 PP
| |||||||
| 2 | ELK | 24.7 | 5.5e-09 | 7 | 28 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22
E+K+ L+ KYsgy+ sLk+ F+
CA03g26510 7 EIKDKLMGKYSGYITSLKHNFC 28
89****************9887 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51213 | 8.748 | 7 | 27 | IPR005539 | ELK domain |
| Pfam | PF03789 | 1.9E-7 | 7 | 28 | IPR005539 | ELK domain |
| SMART | SM01188 | 2.4E-4 | 7 | 28 | IPR005539 | ELK domain |
| PROSITE profile | PS50071 | 11.11 | 27 | 90 | IPR001356 | Homeobox domain |
| SMART | SM00389 | 4.1E-11 | 29 | 94 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 2.57E-19 | 29 | 100 | IPR009057 | Homeodomain-like |
| CDD | cd00086 | 1.67E-10 | 30 | 91 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 4.5E-27 | 33 | 92 | IPR009057 | Homeodomain-like |
| Pfam | PF05920 | 4.7E-17 | 47 | 86 | IPR008422 | Homeobox KN domain |
| PROSITE pattern | PS00027 | 0 | 65 | 88 | IPR017970 | Homeobox, conserved site |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 109 aa Download sequence Send to blast |
MCRRRSEIKD KLMGKYSGYI TSLKHNFCKK NNKGKLPREA TKILFNWWNT HYNWPYPTEV 60 DKVFLAESTG LDPKQINNWF INQRKRHWKP SENMQFAVME TIHGHFSQ* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB025713 | 4e-92 | AB025713.1 Nicotiana tabacum mRNA for homeobox 9, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019244737.1 | 5e-60 | PREDICTED: homeobox protein knotted-1-like 2 | ||||
| Swissprot | Q84JS6 | 5e-41 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
| TrEMBL | A0A2G2XZ36 | 6e-77 | A0A2G2XZ36_CAPAN; Uncharacterized protein | ||||
| STRING | XP_009618137.1 | 1e-58 | (Nicotiana tomentosiformis) | ||||
| STRING | PGSC0003DMT400087440 | 9e-59 | (Solanum tuberosum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA753 | 24 | 80 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G23380.1 | 2e-43 | KNOTTED1-like homeobox gene 6 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




