![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | CA05g09600 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 104aa MW: 11728.6 Da PI: 9.8731 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 55.9 | 1.4e-17 | 10 | 56 | 1 | 48 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
lppGfrFhPtdeel+++yL ++++++++++ ++i+e+d+yk++Pw+Lp
CA05g09600 10 LPPGFRFHPTDEELIMYYLPNQATSRPCPV-SIIPEFDVYKFDPWQLP 56
79****************************.89**************9 PP
| |||||||
| 2 | NAM | 34.5 | 6.2e-11 | 63 | 101 | 73 | 112 |
NAM 73 rknratksgyWkatgkdkevlskkgelvglkktLvfykgr 112
r+nra+ sgyWkatg+dk+++s +++ vg+kk Lvf + +
CA05g09600 63 RPNRAAVSGYWKATGTDKAIYS-GSTYVGIKKALVFLQRK 101
89********************.999**********9654 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 6.28E-34 | 8 | 101 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 25.898 | 10 | 103 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.2E-14 | 11 | 98 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 104 aa Download sequence Send to blast |
MVGKNSSEHL PPGFRFHPTD EELIMYYLPN QATSRPCPVS IIPEFDVYKF DPWQLPGLKI 60 WIRPNRAAVS GYWKATGTDK AIYSGSTYVG IKKALVFLQR KVP* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 3e-29 | 9 | 103 | 14 | 126 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269|PubMed:29760199}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269|PubMed:29760199}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CU468639 | 9e-41 | CU468639.4 S.lycopersicum DNA sequence from clone SL_MboI-101P13 on chromosome 4, complete sequence. | |||
| GenBank | HG975443 | 9e-41 | HG975443.1 Solanum pennellii chromosome ch04, complete genome. | |||
| GenBank | HG975516 | 9e-41 | HG975516.1 Solanum lycopersicum chromosome ch04, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009781251.1 | 1e-53 | PREDICTED: NAC transcription factor 29-like | ||||
| Refseq | XP_016451619.1 | 1e-53 | PREDICTED: NAC transcription factor 29-like | ||||
| Swissprot | K4BNG7 | 2e-53 | NAP2_SOLLC; NAC domain-containing protein 2 | ||||
| TrEMBL | A0A2G2ZHN5 | 4e-71 | A0A2G2ZHN5_CAPAN; NAC transcription factor NAM-B2 | ||||
| STRING | XP_009781251.1 | 4e-53 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA746 | 24 | 103 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G69490.1 | 2e-47 | NAC-like, activated by AP3/PI | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




