![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | CA06g20500 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 96aa MW: 10575.1 Da PI: 4.7207 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 115.5 | 2.6e-36 | 1 | 66 | 30 | 95 |
NF-YC 30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdi 95
+kadedv+misae+Pvl++kace+fi eltlrsw+h+eenkrrtl+k+diaaa++rtd+fdflvdi
CA06g20500 1 MKADEDVRMISAETPVLFAKACEMFIQELTLRSWIHSEENKRRTLQKNDIAAAISRTDTFDFLVDI 66
9****************************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF00808 | 2.0E-14 | 1 | 54 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| SuperFamily | SSF47113 | 5.2E-23 | 1 | 66 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 2.1E-29 | 1 | 66 | IPR009072 | Histone-fold |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
MKADEDVRMI SAETPVLFAK ACEMFIQELT LRSWIHSEEN KRRTLQKNDI AAAISRTDTF 60 DFLVDIGCWA WASAGWCAVL LPSVGPAASG WGNAW* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_B | 8e-37 | 1 | 66 | 27 | 92 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 41 | 47 | RRTLQKN |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016576949.1 | 1e-39 | PREDICTED: nuclear transcription factor Y subunit C-1-like isoform X1 | ||||
| Refseq | XP_016576950.1 | 1e-39 | PREDICTED: nuclear transcription factor Y subunit C-1-like isoform X2 | ||||
| Swissprot | Q8LCG7 | 9e-38 | NFYC2_ARATH; Nuclear transcription factor Y subunit C-2 | ||||
| TrEMBL | A0A2G2ZCS4 | 2e-63 | A0A2G2ZCS4_CAPAN; Nuclear transcription factor Y subunit C-3 | ||||
| STRING | POPTR_0005s09770.1 | 5e-37 | (Populus trichocarpa) | ||||
| STRING | POPTR_0007s07830.1 | 5e-37 | (Populus trichocarpa) | ||||
| STRING | cassava4.1_014024m | 5e-37 | (Manihot esculenta) | ||||
| STRING | XP_010060857.1 | 6e-37 | (Eucalyptus grandis) | ||||
| STRING | EFJ16176 | 3e-37 | (Selaginella moellendorffii) | ||||
| STRING | EFJ17045 | 3e-37 | (Selaginella moellendorffii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA17621 | 4 | 4 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G56170.2 | 1e-39 | nuclear factor Y, subunit C2 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




