PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

CA08g16320

Organism

Capsicum annuum

Taxonomic ID

4072

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum

Family

M-type_MADS

Protein Properties

Length: 94aa MW: 10765.7 Da PI: 10.8047

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
CA08g16320	genome	PEP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	85.6	2.9e-27	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n + rqvtfskRr g++KKA+ELS+LCda++ +i+fs tgkl+eyss CA08g16320 9 KKIDNLTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSS 59 68***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	28.637	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	7.7E-39	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.57E-27	3	67	IPR002100	Transcription factor, MADS-box
CDD	cd00265	5.10E-33	3	62	No hit	No description
PRINTS	PR00404	8.5E-27	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	4.4E-25	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.5E-27	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.5E-27	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
MVRQKIQIKK IDNLTARQVT FSKRRRGLFK KAQELSTLCD ADIGLIVFSA TGKLFEYSSS 60 RFAIHDFLLF FLLLTDKLPS EKSIRCRCFS KNS*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	3e-17	1	60	1	60	MEF2C
5f28_B	3e-17	1	60	1	60	MEF2C
5f28_C	3e-17	1	60	1	60	MEF2C
5f28_D	3e-17	1	60	1	60	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that mediates floral transition in response to vernalization. Promotes inflorescence fate in apical meristems. Acts in a dosage-dependent manner. Probably involved in the transduction of RLK-mediated signaling (e.g. IMK3 pathway). Together with AP1 and SVP, controls the identity of the floral meristem and regulates expression of class B, C and E genes. When associated with SOC1, mediates effect of gibberellins on flowering under short-day conditions, and regulates the expression of LEAFY (LFY), which links floral induction and floral development. Confers inflorescence characteristics to floral primordia and early flowering. {ECO:0000269\|PubMed:12451184, ECO:0000269\|PubMed:12609028, ECO:0000269\|PubMed:12881501, ECO:0000269\|PubMed:14716314, ECO:0000269\|PubMed:16679456, ECO:0000269\|PubMed:18339670, ECO:0000269\|PubMed:18466303, ECO:0000269\|PubMed:18694458, ECO:0000269\|PubMed:19656343}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by vernalization in a FLC-independent manner. Repressed by the floral homeotic genes AP1, LFY and SEP3 in emerging floral meristems to establish a floral identity and prevent inflorescence fate. Up-regulated at the shoot apex by SOC1. {ECO:0000269\|PubMed:12609028, ECO:0000269\|PubMed:14716314, ECO:0000269\|PubMed:17428825, ECO:0000269\|PubMed:18339670, ECO:0000269\|PubMed:18694458}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU664447	9e-87	EU664447.1 Physalis pubescens MADS-box transcription factor MPF1 gene, complete cds.
GenBank	EU664448	9e-87	EU664448.1 Physalis peruviana MADS-box transcription factor MPP2 gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015068707.1	7e-35	MADS-box protein SVP-like
Swissprot	O82794	1e-29	AGL24_ARATH; MADS-box protein AGL24
TrEMBL	G8XQX5	1e-33	G8XQX5_9SOLA; MADS-box transcription factor MPP2
TrEMBL	M1D728	6e-34	M1D728_SOLTU; Uncharacterized protein
TrEMBL	Q537H1	1e-33	Q537H1_9SOLA; MPP2
STRING	XP_009802200.1	6e-34	(Nicotiana sylvestris)
STRING	PGSC0003DMT400083739	4e-34	(Solanum tuberosum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G24540.1	4e-32	AGAMOUS-like 24

Publications ? help Back to Top
Ramamoorthy R,Phua EE,Lim SH,Tan HT,Kumar PP Identification and characterization of RcMADS1, an AGL24 ortholog from the holoparasitic plant Rafflesia cantleyi Solms-Laubach (Rafflesiaceae). PLoS ONE, 2013. 8(6): p. e67243 [PMID:23840638] Lei HJ, et al. Identification and characterization of FaSOC1, a homolog of SUPPRESSOR OF OVEREXPRESSION OF CONSTANS1 from strawberry. Gene, 2013. 531(2): p. 158-67 [PMID:24055423] Wells CE,Vendramin E,Jimenez Tarodo S,Verde I,Bielenberg DG A genome-wide analysis of MADS-box genes in peach [Prunus persica (L.) Batsch]. BMC Plant Biol., 2015. 15: p. 41 [PMID:25848674] Sacharowski SP, et al. SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development. Plant Cell, 2015. 27(7): p. 1889-906 [PMID:26106148] Sun LM,Zhang JZ,Hu CG Characterization and Expression Analysis of PtAGL24, a SHORT VEGETATIVE PHASE/AGAMOUS-LIKE 24 (SVP/AGL24)-Type MADS-Box Gene from Trifoliate Orange (Poncirus trifoliata L. Raf.). Front Plant Sci, 2016. 7: p. 823 [PMID:27375669]