PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

CA09g06810

Organism

Capsicum annuum

Taxonomic ID

4072

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum

Family

MYB_related

Protein Properties

Length: 59aa MW: 7193.39 Da PI: 11.3548

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
CA09g06810	genome	PEP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	31.8	3.3e-10	10	48	9	47
HHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 9 dellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 + +++ + +++G+g+W+ I+++m Rt+ q+ s+ qky CA09g06810 10 HRRFLMGLEKYGKGDWRNISKKMVISRTPTQVASHAQKY 48 889*******************99**********9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	11.792	1	53	IPR017930	Myb domain
SuperFamily	SSF46689	1.57E-11	9	52	IPR009057	Homeodomain-like
Pfam	PF00249	1.7E-8	10	48	IPR001005	SANT/Myb domain
CDD	cd00167	2.35E-5	10	48	No hit	No description
TIGRFAMs	TIGR01557	1.6E-13	10	51	IPR006447	Myb domain, plants
Gene3D	G3DSA:1.10.10.60	2.5E-7	11	48	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 59 aa Download sequence Send to blast
MLIEFFKIWH RRFLMGLEKY GKGDWRNISK KMVISRTPTQ VASHAQKYYQ SQDFRRQR*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269\|PubMed:12172034, ECO:0000269\|PubMed:20130099}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269\|PubMed:12172034, ECO:0000269\|PubMed:20130099}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC246857	9e-58	AC246857.3 Solanum lycopersicum strain Heinz 1706 chromosome 3 clone slm-2l14 map 3, complete sequence.
GenBank	HG975442	9e-58	HG975442.1 Solanum pennellii chromosome ch03, complete genome.
GenBank	HG975515	9e-58	HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006362986.1	3e-22	PREDICTED: transcription factor DIVARICATA-like
Swissprot	Q7XC57	8e-19	MYBS3_ORYSJ; Transcription factor MYBS3
TrEMBL	A0A2G2YSA9	1e-35	A0A2G2YSA9_CAPAN; Uncharacterized protein
STRING	Solyc03g096350.2.1	1e-21	(Solanum lycopersicum)
STRING	PGSC0003DMT400053433	1e-21	(Solanum tuberosum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA21895	2	2

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G11280.2	1e-21	MYB family protein

Publications ? help Back to Top
Rice Chromosome 10 Sequencing Consortium In-depth view of structure, activity, and evolution of rice chromosome 10. Science, 2003. 300(5625): p. 1566-9 [PMID:12791992] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Su CF, et al. A novel MYBS3-dependent pathway confers cold tolerance in rice. Plant Physiol., 2010. 153(1): p. 145-58 [PMID:20130099]