PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

CA10g13480

Organism

Capsicum annuum

Taxonomic ID

4072

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum

Family

WRKY

Protein Properties

Length: 158aa MW: 17465.5 Da PI: 8.463

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
CA10g13480	genome	PEP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	104.4	6e-33	10	67	2	59
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers+ed ++v++tYeg+H h+ CA10g13480 10 EDGYRWRKYGQKAVKNSPFPRSYYRCTNTKCTVKKRVERSSEDSSIVITTYEGQHCHH 67 8******************************************************997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	4.0E-32	2	68	IPR003657	WRKY domain
SuperFamily	SSF118290	2.35E-28	3	67	IPR003657	WRKY domain
PROSITE profile	PS50811	29.344	4	69	IPR003657	WRKY domain
SMART	SM00774	2.8E-38	9	68	IPR003657	WRKY domain
Pfam	PF03106	7.2E-26	10	67	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009414	Biological Process	response to water deprivation
GO:0009651	Biological Process	response to salt stress
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 158 aa Download sequence Send to blast
MTKSEVDHLE DGYRWRKYGQ KAVKNSPFPR SYYRCTNTKC TVKKRVERSS EDSSIVITTY 60 EGQHCHHTVG FPRGGLINHE AAFTSQLSPL PSQYYHPSGV QYPHELVPMT AAAPVESRTM 120 PGETGSSEAR RLPETSQPAA TDEGLLGDIV PPGMRSK*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	1e-25	1	66	9	74	Probable WRKY transcription factor 4
2lex_A	1e-25	1	66	9	74	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00067	PBM	Transfer from AT1G69310	Download

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT013933	1e-144	BT013933.1 Lycopersicon esculentum clone 132931F, mRNA sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016547995.1	1e-115	PREDICTED: probable WRKY transcription factor 57
Swissprot	Q9C983	8e-51	WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBL	A0A2G2VKZ2	1e-114	A0A2G2VKZ2_CAPBA; Putative WRKY transcription factor 28
STRING	Solyc05g012500.2.1	5e-96	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA8031	22	28

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69310.2	3e-53	WRKY DNA-binding protein 57

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Jiang Y,Qiu Y,Hu Y,Yu D Heterologous Expression of AtWRKY57 Confers Drought Tolerance in Oryza sativa. Front Plant Sci, 2016. 7: p. 145 [PMID:26904091] Jiang Y,Yu D The WRKY57 Transcription Factor Affects the Expression of Jasmonate ZIM-Domain Genes Transcriptionally to Compromise Botrytis cinerea Resistance. Plant Physiol., 2016. 171(4): p. 2771-82 [PMID:27268959] Huang KC,Lin WC,Cheng WH Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis. BMC Plant Biol., 2018. 18(1): p. 40 [PMID:29490615]