![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | CA11g12710 | ||||||||
| Common Name | LOC107854652, LOC107856248, WRKY-b | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 152aa MW: 17470.9 Da PI: 10.2936 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 105.2 | 3.4e-33 | 72 | 130 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg H h+
CA11g12710 72 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLSKDEGVVVTTYEGMHSHP 130
59********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 2.8E-34 | 57 | 130 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 5.49E-30 | 64 | 131 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 30.148 | 67 | 132 | IPR003657 | WRKY domain |
| SMART | SM00774 | 4.8E-39 | 72 | 131 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 6.3E-27 | 73 | 130 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0000122 | Biological Process | negative regulation of transcription from RNA polymerase II promoter | ||||
| GO:0010055 | Biological Process | atrichoblast differentiation | ||||
| GO:0032107 | Biological Process | regulation of response to nutrient levels | ||||
| GO:0043620 | Biological Process | regulation of DNA-templated transcription in response to stress | ||||
| GO:0048527 | Biological Process | lateral root development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 152 aa Download sequence Send to blast |
MNKKRSNTHA KEVLLFQGKN NGFLGLMASM ETPSGVTNSF EDDVMKSCKK KGEKKIKKPR 60 YAFQTRSQVD ILDDGYRWRK YGQKAVKNNK FPRSYYRCTH QGCNVKKQVQ RLSKDEGVVV 120 TTYEGMHSHP IDKSTDNFEQ ILSQMQVYAS F* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 1e-28 | 62 | 129 | 7 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 1e-28 | 62 | 129 | 7 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00506 | DAP | Transfer from AT5G13080 | Download |
| |||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY743433 | 0.0 | AY743433.1 Capsicum annuum WRKY transcription factor-b (WRKY-b) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016555165.1 | 1e-111 | PREDICTED: probable WRKY transcription factor 75 | ||||
| Refseq | XP_016556725.1 | 1e-111 | PREDICTED: probable WRKY transcription factor 75 | ||||
| Swissprot | Q9FYA2 | 2e-56 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
| TrEMBL | A0A1U8FDE7 | 1e-110 | A0A1U8FDE7_CAPAN; probable WRKY transcription factor 75 | ||||
| TrEMBL | Q5DJU0 | 1e-110 | Q5DJU0_CAPAN; Putative WRKY transcription factor 24 | ||||
| STRING | XP_009615508.1 | 2e-80 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA2204 | 24 | 61 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G13080.1 | 1e-58 | WRKY DNA-binding protein 75 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Entrez Gene | 107854652 | 107856248 |




