PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

CA12g10410

Organism

Capsicum annuum

Taxonomic ID

4072

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum

Family

G2-like

Protein Properties

Length: 91aa MW: 10394.3 Da PI: 10.1902

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
CA12g10410	genome	PEP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	88.1	8e-28	1	52	4	55
G2-like 4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 ++WtpeLHe+F+ea+++LG se+AtPk +l+lmkv+ Lt++hvk HLQkYR+ CA12g10410 1 MHWTPELHEAFMEAINKLGRSERATPKGVLKLMKVEVLTIYHVKCHLQKYRM 52 78*************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
TIGRFAMs	TIGR01557	4.1E-22	1	52	IPR006447	Myb domain, plants
SuperFamily	SSF46689	2.78E-15	1	53	IPR009057	Homeodomain-like
PROSITE profile	PS51294	10.135	1	55	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.6E-25	1	54	IPR009057	Homeodomain-like
Pfam	PF00249	2.3E-6	2	51	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 91 aa Download sequence Send to blast
MHWTPELHEA FMEAINKLGR SERATPKGVL KLMKVEVLTI YHVKCHLQKY RMARYKPEAS 60 KGSEKKESSI SDLLSLDLKI SIEITKALRL *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6j4k_A	3e-29	1	56	5	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B	3e-29	1	56	5	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A	3e-29	1	56	5	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C	3e-29	1	56	5	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D	3e-29	1	56	5	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F	3e-29	1	56	5	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H	3e-29	1	56	5	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J	3e-29	1	56	5	60	Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in phosphate starvation signaling (PubMed:11511543, PubMed:17927693, PubMed:26586833). Binds as a dimer to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:11511543, PubMed:20838596, PubMed:26586833). SPX1 is a competitive inhibitor of this DNA-binding (PubMed:25271326). PHR1 binding to its targets is low Pi-dependent (PubMed:25271326). Regulates the expression of miR399 (PubMed:20838596). Regulates the expression of IPS1 (At3g09922), a non-coding RNA that mimics the target of miR399 to block the cleavage of PHO2 under Pi-deficient conditions (PubMed:17643101). Regulates lipid remodeling and triacylglycerol accumulation during phosphorus starvation (PubMed:25680792). Required for the shoot-specific hypoxic response (PubMed:24753539). Regulates FER1 expression upon phosphate starvation, linking iron and phosphate homeostasis (PubMed:23788639). Contributes to the homeostasis of both sulfate and phosphate in plants under phosphate deficiency (PubMed:21261953). Required for adaptation to high light and retaining functional photosynthesis during phosphate starvation (PubMed:21910737). Involved in the coregulation of Zn and Pi homeostasis (PubMed:24420568). {ECO:0000269\|PubMed:11511543, ECO:0000269\|PubMed:17643101, ECO:0000269\|PubMed:17927693, ECO:0000269\|PubMed:20838596, ECO:0000269\|PubMed:21261953, ECO:0000269\|PubMed:21910737, ECO:0000269\|PubMed:23788639, ECO:0000269\|PubMed:24420568, ECO:0000269\|PubMed:24753539, ECO:0000269\|PubMed:25271326, ECO:0000269\|PubMed:25680792, ECO:0000269\|PubMed:26586833}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Only moderately up-regulated by Pi starvation. {ECO:0000269\|PubMed:11511543}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016576060.1	3e-46	PREDICTED: protein PHR1-LIKE 1-like isoform X1
Refseq	XP_016576061.1	3e-46	PREDICTED: protein PHR1-LIKE 1-like isoform X2
Swissprot	Q94CL7	9e-36	PHR1_ARATH; Protein PHOSPHATE STARVATION RESPONSE 1
TrEMBL	A0A2G2Y8P9	1e-58	A0A2G2Y8P9_CAPAN; Uncharacterized protein
STRING	XP_009781296.1	3e-42	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12062	16	23

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G28610.1	2e-29	phosphate starvation response 1

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Matsui K,Togami J,Mason JG,Chandler SF,Tanaka Y Enhancement of phosphate absorption by garden plants by genetic engineering: a new tool for phytoremediation. Biomed Res Int, 2013. 2013: p. 182032 [PMID:23984322] Jost R, et al. Differentiating phosphate-dependent and phosphate-independent systemic phosphate-starvation response networks in Arabidopsis thaliana through the application of phosphite. J. Exp. Bot., 2015. 66(9): p. 2501-14 [PMID:25697796] Zhou Z, et al. SPX proteins regulate Pi homeostasis and signaling in different subcellular level. Plant Signal Behav, 2015. 10(9): p. e1061163 [PMID:26224365] Bonnot C, et al. A chemical genetic strategy identify the PHOSTIN, a synthetic molecule that triggers phosphate starvation responses in Arabidopsis thaliana. New Phytol., 2016. 209(1): p. 161-76 [PMID:26243630] Khan GA,Vogiatzaki E,Glauser G,Poirier Y Phosphate Deficiency Induces the Jasmonate Pathway and Enhances Resistance to Insect Herbivory. Plant Physiol., 2016. 171(1): p. 632-44 [PMID:27016448] Velasco VM, et al. Acclimation of the crucifer Eutrema salsugineum to phosphate limitation is associated with constitutively high expression of phosphate-starvation genes. Plant Cell Environ., 2016. 39(8): p. 1818-34 [PMID:27038434] Yong-Villalobos L, et al. Phosphate starvation induces DNA methylation in the vicinity of cis-acting elements known to regulate the expression of phosphate-responsive genes. Plant Signal Behav, 2016. 11(5): p. e1173300 [PMID:27185363] Li Y,Wu H,Fan H,Zhao T,Ling HQ Characterization of the AtSPX3 Promoter Elucidates its Complex Regulation in Response to Phosphorus Deficiency. Plant Cell Physiol., 2016. 57(8): p. 1767-78 [PMID:27382128] Zhang H,Huang L,Hong Y,Song F BOTRYTIS-INDUCED KINASE1, a plasma membrane-localized receptor-like protein kinase, is a negative regulator of phosphate homeostasis in Arabidopsis thaliana. BMC Plant Biol., 2016. 16(1): p. 152 [PMID:27389008] Yuan J, et al. Systematic characterization of novel lncRNAs responding to phosphate starvation in Arabidopsis thaliana. BMC Genomics, 2016. 17: p. 655 [PMID:27538394] Linn J, et al. Root Cell-Specific Regulators of Phosphate-Dependent Growth. Plant Physiol., 2017. 174(3): p. 1969-1989 [PMID:28465462] Aleksza D,Horváth GV,Sándor G,Szabados L Proline Accumulation Is Regulated by Transcription Factors Associated with Phosphate Starvation. Plant Physiol., 2017. 175(1): p. 555-567 [PMID:28765275] Liu Y, et al. Light and Ethylene Coordinately Regulate the Phosphate Starvation Response through Transcriptional Regulation of PHOSPHATE STARVATION RESPONSE1. Plant Cell, 2017. 29(9): p. 2269-2284 [PMID:28842534] Qi W,Manfield IW,Muench SP,Baker A AtSPX1 affects the AtPHR1-DNA-binding equilibrium by binding monomeric AtPHR1 in solution. Biochem. J., 2017. 474(21): p. 3675-3687 [PMID:28887383] Huang KL, et al. The ARF7 and ARF19 Transcription Factors Positively Regulate PHOSPHATE STARVATION RESPONSE1 in Arabidopsis Roots. Plant Physiol., 2018. 178(1): p. 413-427 [PMID:30026290] Jiang M, et al. Structural basis for the Target DNA recognition and binding by the MYB domain of phosphate starvation response 1. FEBS J., 2019. [PMID:30974511]