PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG012265.1
Organism
Populus euphratica
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 135aa    MW: 15621.5 Da    PI: 9.5108
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG012265.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.61.2e-125598145
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     rg W + Ed +l++  +++G+ +W++Ia+++  gR+ k+c++rw+
      CCG012265.1 55 RGYWRPAEDSKLKEPGALHGPQNWNLIAEKLK-GRSSKSCRLRWF 98
                     899****************************9.***********7 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.34550105IPR017930Myb domain
SuperFamilySSF466891.1E-1453115IPR009057Homeodomain-like
SMARTSM007177.3E-954103IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.4E-2157119IPR009057Homeodomain-like
PfamPF139216.4E-1358118No hitNo description
CDDcd001671.82E-85897No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
MGKCCSSRLE NEQYSEVGDD GRKREDNDAL IENTNKSLVS GKERMEGDKY KVCNRGYWRP  60
AEDSKLKEPG ALHGPQNWNL IAEKLKGRSS KSCRLRWFHR VNPKINRIAF NEEEEERLMA  120
AHKVYAGRTS RHGQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-1355135787B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for sugar partitioning from leaves to anthers during male reproductive development. Required for the production of functional pollen grains. Binds to the promoter of the anther-specific sugar transporter MST8 and regulates its expression. Regulates the expression of genes involved in sugar partitioning in flower, such as the sugar transporter SUT3, the invertase INV4, the UDP-glucose pyrophosphorylase UGP2 and the starch synthase WAXY. {ECO:0000269|PubMed:20305120}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by wounding. {ECO:0000269|PubMed:20305120}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011002493.16e-97PREDICTED: transcription factor MYB44-like
SwissprotQ5NBM87e-34CSA_ORYSJ; Transcription factor CSA
TrEMBLA0A2K1X5492e-52A0A2K1X549_POPTR; Uncharacterized protein
TrEMBLA0A3N7G6X31e-52A0A3N7G6X3_POPTR; Uncharacterized protein
TrEMBLB9IJZ82e-52B9IJZ8_POPTR; Uncharacterized protein
STRINGPOPTR_0017s12140.14e-53(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.12e-35myb domain protein 105
Publications ? help Back to Top
  1. Leonard LM,Follette VM
    Sexual functioning in women reporting a history of child sexual abuse: review of the empirical literature and clinical implications.
    Annu Rev Sex Res, 2002. 13: p. 346-88
    [PMID:12836736]
  2. Wang L,Li X,Chen Z
    Sulfated modification of the polysaccharides obtained from defatted rice bran and their antitumor activities.
    Int. J. Biol. Macromol., 2009. 44(2): p. 211-4
    [PMID:19135473]
  3. Wang L,Huang H,Wei Y,Li X,Chen Z
    Characterization and anti-tumor activities of sulfated polysaccharide SRBPS2a obtained from defatted rice bran.
    Int. J. Biol. Macromol., 2009. 45(4): p. 427-31
    [PMID:19549538]
  4. Zhang H, et al.
    Carbon starved anther encodes a MYB domain protein that regulates sugar partitioning required for rice pollen development.
    Plant Cell, 2010. 22(3): p. 672-89
    [PMID:20305120]
  5. Zhang H, et al.
    Mutation in CSA creates a new photoperiod-sensitive genic male sterile line applicable for hybrid rice seed production.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(1): p. 76-81
    [PMID:23256151]
  6. Zhu X, et al.
    Brassinosteroids promote development of rice pollen grains and seeds by triggering expression of Carbon Starved Anther, a MYB domain protein.
    Plant J., 2015. 82(4): p. 570-81
    [PMID:25754973]
  7. Li X, et al.
    Metabolic and transcriptomic signatures of rice floral organs reveal sugar starvation as a factor in reproductive failure under heat and drought stress.
    Plant Cell Environ., 2015. 38(10): p. 2171-92
    [PMID:25828772]
  8. Shaar-Moshe L,Hübner S,Peleg Z
    Identification of conserved drought-adaptive genes using a cross-species meta-analysis approach.
    BMC Plant Biol., 2015. 15: p. 111
    [PMID:25935420]