![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | CCG012442.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 163aa MW: 19031.5 Da PI: 9.2865 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 161.4 | 3.5e-50 | 14 | 140 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk... 95
lppGfrF+Ptdeelv +yLk+k+ + +l++ +vi+ev+++k++Pw+Lp e+e yfFs++++ky++g+r nr+ +sgyWkatg dk+++s+
CCG012442.1 14 LPPGFRFQPTDEELVFQYLKRKILSWPLPA-SVIHEVNVCKYDPWELPGD---MEQERYFFSNKETKYPNGNRVNRSSASGYWKATGLDKQIVSSswk 107
79****************************.99***************54...46799************************************9888 PP
NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
+++ vg+kktLvfy+g+a +g++tdWvmheyrl
CCG012442.1 108 NNHIVGMKKTLVFYRGKATHGSRTDWVMHEYRL 140
8889***************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 2.22E-53 | 10 | 142 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 51.357 | 14 | 155 | IPR003441 | NAC domain |
| Pfam | PF02365 | 3.2E-26 | 15 | 140 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 163 aa Download sequence Send to blast |
MEKLNFVRDG KIRLPPGFRF QPTDEELVFQ YLKRKILSWP LPASVIHEVN VCKYDPWELP 60 GDMEQERYFF SNKETKYPNG NRVNRSSASG YWKATGLDKQ IVSSSWKNNH IVGMKKTLVF 120 YRGKATHGSR TDWVMHEYRL VNVGEETTDC NFPQTENSAQ ASY |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 9e-44 | 11 | 141 | 14 | 143 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 9e-44 | 11 | 141 | 14 | 143 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 9e-44 | 11 | 141 | 14 | 143 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 9e-44 | 11 | 141 | 14 | 143 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 1e-43 | 11 | 141 | 17 | 146 | NAC domain-containing protein 19 |
| 3swm_B | 1e-43 | 11 | 141 | 17 | 146 | NAC domain-containing protein 19 |
| 3swm_C | 1e-43 | 11 | 141 | 17 | 146 | NAC domain-containing protein 19 |
| 3swm_D | 1e-43 | 11 | 141 | 17 | 146 | NAC domain-containing protein 19 |
| 3swp_A | 1e-43 | 11 | 141 | 17 | 146 | NAC domain-containing protein 19 |
| 3swp_B | 1e-43 | 11 | 141 | 17 | 146 | NAC domain-containing protein 19 |
| 3swp_C | 1e-43 | 11 | 141 | 17 | 146 | NAC domain-containing protein 19 |
| 3swp_D | 1e-43 | 11 | 141 | 17 | 146 | NAC domain-containing protein 19 |
| 4dul_A | 9e-44 | 11 | 141 | 14 | 143 | NAC domain-containing protein 19 |
| 4dul_B | 9e-44 | 11 | 141 | 14 | 143 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KP770013 | 0.0 | KP770013.1 Populus tomentosa trans-cinnamate 4-monooxygenase (Potri.015G102100) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011023926.1 | 1e-120 | PREDICTED: NAC transcription factor 25-like | ||||
| Swissprot | Q9FY93 | 1e-70 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
| TrEMBL | A0A0F6V052 | 1e-112 | A0A0F6V052_POPTO; Trans-cinnamate 4-monooxygenase | ||||
| STRING | POPTR_0012s10530.1 | 1e-108 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF704 | 34 | 139 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G13180.1 | 5e-73 | NAC domain containing protein 83 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




