PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

CCG025544.1

Organism

Populus euphratica

Taxonomic ID

75702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus

Family

MYB_related

Protein Properties

Length: 144aa MW: 16552.2 Da PI: 4.4615

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
CCG025544.1	genome	LZU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	30.2	1e-09	24	66	1	45
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 ++ ++++E+ l+ + ++ G + W++Ia +++ gRt++++ +w CCG025544.1 24 KLEFSEDEETLITRMYNLVGER-WTLIAGRIP-GRTAEEIEKYWT 66 678*****************.*****.*********5 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50090	7.05	19	69	IPR017877	Myb-like domain
SMART	SM00717	4.9E-8	23	71	IPR001005	SANT/Myb domain
Pfam	PF00249	2.1E-8	25	66	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	5.07E-8	26	69	IPR009057	Homeodomain-like
CDD	cd00167	5.17E-7	26	65	No hit	No description
Gene3D	G3DSA:1.10.10.60	8.1E-12	26	67	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 144 aa Download sequence Send to blast
MADSDHSSSD DLSVDSRDTS QDTKLEFSED EETLITRMYN LVGERWTLIA GRIPGRTAEE 60 IEKYWTSRYS TINSNECLMT RMHEMSLDYH FTVEQEMGSA TYPTAGFWSF SAENEAGGWK 120 NRTTVLEDMD LAIRASLKGR KYHI

Functional Description ? help Back to Top
Source	Description
UniProt	Possesses glucomannan synthase and mannan synthase activities in vitro. Mannan synthase consists of a 4-beta-mannosyltransferase activity on mannan using GDP-mannose. The beta-1,4-mannan product is the backbone for galactomannan synthesis by galactomannan galactosyltransferase. Galactomannan is a noncellulosic polysaccharides of plant cell wall (PubMed:15647349, PubMed:17307900). Required for lateral root development (PubMed:14612582). {ECO:0000269\|PubMed:14612582, ECO:0000269\|PubMed:15647349, ECO:0000269\|PubMed:17307900}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	FQ397516	3e-44	FQ397516.1 Vitis vinifera clone SS0AEB6YI23.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Swissprot	Q9LZR3	4e-31	CSLA9_ARATH; Glucomannan 4-beta-mannosyltransferase 9

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF2692	31	78

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G46410.1	4e-19	MYB_related family protein

Publications ? help Back to Top
Nam J, et al. Identification of T-DNA tagged Arabidopsis mutants that are resistant to transformation by Agrobacterium. Mol. Gen. Genet., 1999. 261(3): p. 429-38 [PMID:10323222] Richmond TA,Somerville CR The cellulose synthase superfamily. Plant Physiol., 2000. 124(2): p. 495-8 [PMID:11027699] Zhu Y,Nam J,Carpita NC,Matthysse AG,Gelvin SB Agrobacterium-mediated root transformation is inhibited by mutation of an Arabidopsis cellulose synthase-like gene. Plant Physiol., 2003. 133(3): p. 1000-10 [PMID:14612582] Liepman AH,Wilkerson CG,Keegstra K Expression of cellulose synthase-like (Csl) genes in insect cells reveals that CslA family members encode mannan synthases. Proc. Natl. Acad. Sci. U.S.A., 2005. 102(6): p. 2221-6 [PMID:15647349] Roberts AW,Bushoven JT The cellulose synthase (CESA) gene superfamily of the moss Physcomitrella patens. Plant Mol. Biol., 2007. 63(2): p. 207-19 [PMID:17006591] Liepman AH, et al. Functional genomic analysis supports conservation of function among cellulose synthase-like a gene family members and suggests diverse roles of mannans in plants. Plant Physiol., 2007. 143(4): p. 1881-93 [PMID:17307900] Goubet F, et al. Cell wall glucomannan in Arabidopsis is synthesised by CSLA glycosyltransferases, and influences the progression of embryogenesis. Plant J., 2009. 60(3): p. 527-38 [PMID:19619156] Davis J,Brandizzi F,Liepman AH,Keegstra K Arabidopsis mannan synthase CSLA9 and glucan synthase CSLC4 have opposite orientations in the Golgi membrane. Plant J., 2010. 64(6): p. 1028-37 [PMID:21143682]