PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

CCG029001.1

Organism

Populus euphratica

Taxonomic ID

75702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus

Family

MYB_related

Protein Properties

Length: 193aa MW: 22274.3 Da PI: 9.739

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
CCG029001.1	genome	LZU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	58.9	1.1e-18	17	64	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+++++ +G+++W++Ia++ ++R++k+c++rw ++l CCG029001.1 17 KGAWTAEEDQKLARVIEIHGPKRWRSIAAKADLNRCGKSCRLRWMNHL 64 79********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	24.868	12	68	IPR017930	Myb domain
SMART	SM00717	4.9E-16	16	66	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	6.24E-23	16	104	IPR009057	Homeodomain-like
Pfam	PF00249	1.5E-17	17	64	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.2E-25	18	71	IPR009057	Homeodomain-like
CDD	cd00167	8.66E-12	19	64	No hit	No description
SMART	SM00717	0.0013	69	110	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	10.769	69	112	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	6.8E-15	72	113	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 193 aa Download sequence Send to blast
MPLAPRRSKC GQREANKGAW TAEEDQKLAR VIEIHGPKRW RSIAAKADLN RCGKSCRLRW 60 MNHLRPNIKR GNISDQEEDL ILRLHKLLAG RLPGRTDNEI KNYWNSHLSK KIKQKEEKPV 120 IISTSKQPEP EKTNALGMDN IAKGREEGTS KRLVDSKSSF AGDDFFDFSN EDPVNLEWMS 180 KFLELEESLY EFP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	7e-26	14	112	1	105	MYB PROTO-ONCOGENE PROTEIN
1h88_C	3e-25	14	112	55	159	MYB PROTO-ONCOGENE PROTEIN
1h89_C	3e-25	14	112	55	159	MYB PROTO-ONCOGENE PROTEIN
1mse_C	9e-26	17	112	4	105	C-Myb DNA-Binding Domain
1msf_C	9e-26	17	112	4	105	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269\|PubMed:10589676, ECO:0000269\|PubMed:11585796, ECO:0000269\|PubMed:14627722, ECO:0000269\|PubMed:15361138, ECO:0000269\|PubMed:15795220, ECO:0000269\|PubMed:16207757}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269\|PubMed:11910008, ECO:0000269\|PubMed:16176989}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	FR828544	4e-38	FR828544.1 Rosa rugosa mRNA for putative MYB transcription factor (myb11 gene).

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011010380.1	1e-138	PREDICTED: transcription factor MYB114-like
Swissprot	Q9SEI0	3e-44	WER_ARATH; Transcription factor WER
TrEMBL	A0A2K1WW01	1e-115	A0A2K1WW01_POPTR; Uncharacterized protein
STRING	POPTR_0018s08500.1	1e-132	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF2148	32	88

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G14750.1	2e-45	myb domain protein 66

Publications ? help Back to Top
Savage N, et al. Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana. PLoS ONE, 2013. 8(10): p. e75452 [PMID:24130712] Cheng Y, et al. Brassinosteroids control root epidermal cell fate via direct regulation of a MYB-bHLH-WD40 complex by GSK3-like kinases. Elife, 2018. [PMID:24771765] Kiefer CS, et al. Correction: Arabidopsis AIP1-2 restricted by WER-mediated patterning modulates planar polarity. Development, 2015. 142(5): p. 1022 [PMID:25715402] Kwak SH,Song SK,Lee MM,Schiefelbein J TORNADO1 regulates root epidermal patterning through the WEREWOLF pathway in Arabidopsis thaliana. Plant Signal Behav, 2015. 10(12): p. e1103407 [PMID:26451798] Zhu Y, et al. The Histone Chaperone NRP1 Interacts with WEREWOLF to Activate GLABRA2 in Arabidopsis Root Hair Development. Plant Cell, 2017. 29(2): p. 260-276 [PMID:28138017] Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana. Plant J., 2017. 92(2): p. 305-316 [PMID:28771873] Mira MM, et al. Expression of Arabidopsis class 1 phytoglobin (AtPgb1) delays death and degradation of the root apical meristem during severe PEG-induced water deficit. J. Exp. Bot., 2017. 68(20): p. 5653-5668 [PMID:29059380] Kohanová J, et al. Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots. Ann. Bot., 2018. 122(5): p. 903-914 [PMID:29394308]