PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cagra.0149s0005.1.p

Organism

Capsella grandiflora

Taxonomic ID

264402

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella

Family

Dof

Protein Properties

Length: 104aa MW: 11865.6 Da PI: 10.0627

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cagra.0149s0005.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	92.6	3.1e-29	54	97	2	45
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGa 45 ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GG Cagra.0149s0005.1.p 54 PDKIIACPRCKSMETKFCYFNNYNVNQPRHFCKGCHRYWTAGGV 97 68999*************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	5.0E-23	53	101	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	3.8E-24	56	97	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	23.188	58	103	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	60	96	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:1902455	Biological Process	negative regulation of stem cell population maintenance
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 104 aa Download sequence Send to blast
MATQDSQGIK LFGKTIAFNT TQTMKREEEI KQPPEQEATT AVRSSSDLTA EKRPDKIIAC 60 PRCKSMETKF CYFNNYNVNQ PRHFCKGCHR YWTAGGVRKS LKR*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269\|PubMed:19619493}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Cagra.0149s0005.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269\|PubMed:19619493}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC002341	3e-90	AC002341.3 Arabidopsis thaliana chromosome 2 clone T14G11 map TEn5, complete sequence.
GenBank	AK221308	3e-90	AK221308.1 Arabidopsis thaliana mRNA for putative DOF zinc finger protein, complete cds, clone: RAFL25-04-B19.
GenBank	BT010496	3e-90	BT010496.1 Arabidopsis thaliana At2g34140 gene, complete cds.
GenBank	CP002685	3e-90	CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006295511.1	2e-67	cyclic dof factor 4
Swissprot	O22967	5e-58	CDF4_ARATH; Cyclic dof factor 4
TrEMBL	R0HFI0	5e-66	R0HFI0_9BRAS; Uncharacterized protein
STRING	Cagra.0149s0005.1.p	3e-73	(Capsella grandiflora)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2809	26	69

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G34140.1	2e-60	Dof family protein

Link Out ? help Back to Top
Phytozome	Cagra.0149s0005.1.p

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Bueso E, et al. Arabidopsis COGWHEEL1 links light perception and gibberellins with seed tolerance to deterioration. Plant J., 2016. 87(6): p. 583-96 [PMID:27227784]