![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cagra.0551s0036.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 153aa MW: 17483.3 Da PI: 6.9119 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 168.4 | 8.8e-53 | 42 | 137 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91
+eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa+a+lGf+dy+ l+ yl++yr
Cagra.0551s0036.1.p 42 KEQDRLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTLNGDDICWAMANLGFDDYAGHLTNYLHRYR 131
89**************************************************************************************** PP
NF-YB 92 elegek 97
+ege+
Cagra.0551s0036.1.p 132 VTEGER 137
***997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.0E-51 | 35 | 146 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 4.19E-39 | 44 | 145 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 7.1E-28 | 47 | 111 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 3.5E-15 | 75 | 93 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 78 | 94 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 3.5E-15 | 94 | 112 | No hit | No description |
| PRINTS | PR00615 | 3.5E-15 | 113 | 131 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 153 aa Download sequence Send to blast |
MAGDNPWFQN PTPRYQNYNF GSSSSRDHHG VDDDRQEEEN IKEQDRLLPI ANVGRIMKNI 60 LPPNAKISKE AKETMQECVS EFISFVTGEA SDKCHKEKRK TLNGDDICWA MANLGFDDYA 120 GHLTNYLHRY RVTEGERANH HHHHHQGKGA RP* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 5e-43 | 41 | 131 | 1 | 91 | Transcription factor HapC (Eurofung) |
| 4g92_B | 5e-43 | 41 | 131 | 1 | 91 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Cagra.0551s0036.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006296212.1 | 1e-105 | nuclear transcription factor Y subunit B-5 | ||||
| Swissprot | O82248 | 8e-80 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | R0HUM7 | 1e-104 | R0HUM7_9BRAS; Uncharacterized protein | ||||
| STRING | Cagra.0551s0036.1.p | 1e-113 | (Capsella grandiflora) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM255 | 28 | 229 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 2e-80 | nuclear factor Y, subunit B5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Cagra.0551s0036.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




