PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cagra.1561s0058.1.p

Organism

Capsella grandiflora

Taxonomic ID

264402

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella

Family

WRKY

Protein Properties

Length: 112aa MW: 13069.9 Da PI: 10.4379

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cagra.1561s0058.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	102.6	2.2e-32	32	90	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk++ fprsYY+Ct++gC+vkk+v+r + d+ vv++tY+g H+h+ Cagra.1561s0058.1.p 32 LDDGYRWRKYGQKAVKNNLFPRSYYKCTQEGCRVKKQVQRLSGDEGVVVTTYQGAHTHP 90 59********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	6.2E-34	17	90	IPR003657	WRKY domain
SuperFamily	SSF118290	3.53E-29	24	91	IPR003657	WRKY domain
PROSITE profile	PS50811	29.505	27	92	IPR003657	WRKY domain
SMART	SM00774	3.9E-37	32	91	IPR003657	WRKY domain
Pfam	PF03106	1.6E-26	33	90	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0006817	Biological Process	phosphate ion transport
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0008134	Molecular Function	transcription factor binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 112 aa Download sequence Send to blast
MKNKEEGKPK SRKKKEREAK FAFQTRSQVD ILDDGYRWRK YGQKAVKNNL FPRSYYKCTQ 60 EGCRVKKQVQ RLSGDEGVVV TTYQGAHTHP VDKPSDNFHH ILTQMHIFPP F*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	1e-27	22	89	7	74	Probable WRKY transcription factor 4
2lex_A	1e-27	22	89	7	74	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250\|UniProtKB:Q9SI37}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00325	DAP	Transfer from AT3G01970	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Cagra.1561s0058.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KC246580	1e-108	KC246580.1 Brassica napus WRKY transcription factor 45.1 (WRKY45.1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006300107.1	1e-79	probable WRKY transcription factor 45
Swissprot	Q9S763	2e-60	WRK45_ARATH; Probable WRKY transcription factor 45
TrEMBL	R0I4U4	2e-78	R0I4U4_9BRAS; Uncharacterized protein
STRING	Cagra.1561s0058.1.p	3e-79	(Capsella grandiflora)
STRING	XP_006300107.1	4e-79	(Capsella rubella)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM509	28	154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G01970.1	5e-61	WRKY DNA-binding protein 45

Link Out ? help Back to Top
Phytozome	Cagra.1561s0058.1.p

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Chen L,Xiang S,Chen Y,Li D,Yu D Arabidopsis WRKY45 Interacts with the DELLA Protein RGL1 to Positively Regulate Age-Triggered Leaf Senescence. Mol Plant, 2017. 10(9): p. 1174-1189 [PMID:28735023]