![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cagra.19206s0001.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 108aa MW: 12082.8 Da PI: 6.0823 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 96.1 | 3.7e-30 | 5 | 102 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89
+Ca+Ck+l+ +C++ C+ p+fp+++ +f+ vh++FGa+nv+k+l++l eere+a+++l+y Aear rdPv+G++g+ l++++ l+
Cagra.19206s0001.1.p 5 RCAVCKILNVTCEPTCICKPHFPSNS-TRFQDVHQIFGAENVHKILNSLGAEEREIAANCLCYAAEARRRDPVSGVYGMKLHYESILND 92
6**********************987.89************************************************************ PP
DUF260 90 lkaelallke 99
+++e++++ +
Cagra.19206s0001.1.p 93 VEQEIKSALN 102
***9988765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 21.261 | 4 | 104 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 5.6E-28 | 5 | 99 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 108 aa Download sequence Send to blast |
MASNRCAVCK ILNVTCEPTC ICKPHFPSNS TRFQDVHQIF GAENVHKILN SLGAEEREIA 60 ANCLCYAAEA RRRDPVSGVY GMKLHYESIL NDVEQEIKSA LNELETNL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 3e-20 | 2 | 104 | 8 | 111 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 3e-20 | 2 | 104 | 8 | 111 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Cagra.19206s0001.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC254591 | 1e-167 | AC254591.1 Capsella rubella clone CAP08-M12, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006282797.1 | 2e-72 | LOB domain-containing protein 32 | ||||
| Swissprot | O49651 | 7e-41 | LBD32_ARATH; LOB domain-containing protein 32 | ||||
| TrEMBL | R0GTP6 | 5e-71 | R0GTP6_9BRAS; Uncharacterized protein | ||||
| STRING | Cagra.19206s0001.1.p | 2e-75 | (Capsella grandiflora) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4525 | 14 | 55 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G22700.1 | 3e-43 | LOB domain-containing protein 32 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Cagra.19206s0001.1.p |




