PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Carubv10010717m

Common Name

CARUB_v10010717mg

Organism

Capsella rubella

Taxonomic ID

81985

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella

Family

MYB_related

Protein Properties

Length: 104aa MW: 12227.3 Da PI: 10.0189

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Carubv10010717m	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	54.2	3.3e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W+ eEd+ll ++++++G ++W++ ++ g+ R++k+c++rw +yl Carubv10010717m 14 KGPWSGEEDQLLTNYITLHGHPNWRALPKLAGLLRCGKSCRLRWINYL 61 79****************************99**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	2.1E-24	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	20.342	9	65	IPR017930	Myb domain
SMART	SM00717	3.2E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	3.1E-14	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	8.98E-22	15	90	IPR009057	Homeodomain-like
CDD	cd00167	1.26E-9	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.5E-7	65	89	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 104 aa Download sequence Send to blast
MGRRPCCEKT GLKKGPWSGE EDQLLTNYIT LHGHPNWRAL PKLAGLLRCG KSCRLRWINY 60 LRPDIKRGNF TSLEEDTIIH LHHILGNRFL LLLFSRIYER YYF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-14	12	89	5	81	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Plays a regulatory role in meristem function. Functions as component of a regulatory network controlling the establishment and/or development of the shoot system by the regulation of apical meristem function (PubMed:9681014). May play a role in tolerance to boric acid (PubMed:16861809). {ECO:0000269\|PubMed:16861809, ECO:0000269\|PubMed:9681014}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Carubv10010717m

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA), drought, light and wounding in leaves. Down-regulated by drought and ABA in roots. {ECO:0000269\|PubMed:9681014}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB493437	3e-90	AB493437.1 Arabidopsis thaliana At1g06180 mRNA for hypothetical protein, partial cds, clone: RAAt1g06180.
GenBank	AY519550	3e-90	AY519550.1 Arabidopsis thaliana MYB transcription factor (At1g06180) mRNA, complete cds.
GenBank	BT025173	3e-90	BT025173.1 Arabidopsis thaliana At1g06180 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006303456.2	1e-61	transcription factor MYB13
Swissprot	Q9LNC9	3e-53	MYB13_ARATH; Transcription factor MYB13
TrEMBL	R0I279	6e-70	R0I279_9BRAS; Uncharacterized protein
STRING	XP_006303456.1	1e-70	(Capsella rubella)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G06180.1	1e-55	myb domain protein 13

Link Out ? help Back to Top
Phytozome	Carubv10010717m
Entrez Gene	17899527

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Huang BH, et al. Positive selection and functional divergence of R2R3-MYB paralogous genes expressed in inflorescence buds of Scutellaria species (Labiatae). Int J Mol Sci, 2015. 16(3): p. 5900-21 [PMID:25782156]