![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Carubv10012265m | ||||||||
| Common Name | CARUB_v10012265mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 91aa MW: 10709.5 Da PI: 10.5219 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 81.3 | 6.3e-26 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krie+ ++rqvtf+kRr+ ++KKA+ELSvLCd+ +iifs +++ly+++s
Carubv10012265m 9 KRIEDRIRRQVTFAKRRKSLMKKAHELSVLCDVHLGLIIFSYSNRLYDFCS 59
79***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 26.338 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 2.9E-30 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.98E-35 | 2 | 80 | No hit | No description |
| PRINTS | PR00404 | 4.7E-24 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.96E-26 | 3 | 84 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.2E-22 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.7E-24 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.7E-24 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0030308 | Biological Process | negative regulation of cell growth | ||||
| GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
| GO:0048530 | Biological Process | fruit morphogenesis | ||||
| GO:0080060 | Biological Process | integument development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 91 aa Download sequence Send to blast |
MRKGKVVIKR IEDRIRRQVT FAKRRKSLMK KAHELSVLCD VHLGLIIFSY SNRLYDFCSN 60 TTSMENLIMR YQMEKEAGHT HTSADHSFHP A |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 1e-18 | 1 | 85 | 1 | 83 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 1e-18 | 1 | 85 | 1 | 83 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 1e-18 | 1 | 85 | 1 | 83 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 1e-18 | 1 | 85 | 1 | 83 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 1e-18 | 1 | 85 | 1 | 83 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 1e-18 | 1 | 85 | 1 | 83 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 1e-18 | 1 | 85 | 1 | 83 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 1e-18 | 1 | 85 | 1 | 83 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 1e-18 | 1 | 85 | 1 | 83 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 1e-18 | 1 | 85 | 1 | 83 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the regulation of fruit growth. Contributes to integument development. Controls organ size via cell expansion (PubMed:20088901). Involved in the regulation of longitudinal growth of the fruit evenly throughout the radial axis (PubMed:20598091). Functions redundantly with TT16/AGL32 to repress nucellus growth and promote its degeneration (PubMed:27233529). {ECO:0000269|PubMed:20088901, ECO:0000269|PubMed:20598091, ECO:0000269|PubMed:27233529}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Carubv10012265m |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB493489 | 3e-77 | AB493489.1 Arabidopsis thaliana At1g31140 mRNA for hypothetical protein, partial cds, clone: RAAt1g31140. | |||
| GenBank | AY141243 | 3e-77 | AY141243.1 Arabidopsis thaliana MADS-box protein AGL63 mRNA, complete cds. | |||
| GenBank | FR671367 | 3e-77 | FR671367.1 Arabidopsis thaliana mRNA for putative MADS domain protein AGL63 (GOA), ecotype Col-0. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006306362.2 | 2e-61 | agamous-like MADS-box protein AGL63 | ||||
| Swissprot | Q9SA07 | 2e-45 | AGL63_ARATH; Agamous-like MADS-box protein AGL63 | ||||
| TrEMBL | A0A2H4FR43 | 4e-60 | A0A2H4FR43_9BRAS; MADS-box transcription factor AGL63 | ||||
| TrEMBL | R0IL24 | 2e-61 | R0IL24_9BRAS; Uncharacterized protein (Fragment) | ||||
| STRING | XP_006306362.1 | 3e-62 | (Capsella rubella) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM78 | 28 | 413 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G31140.2 | 7e-48 | GORDITA | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Carubv10012265m |
| Entrez Gene | 17898037 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




