PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Carubv10017972m

Common Name

CARUB_v10017737mg

Organism

Capsella rubella

Taxonomic ID

81985

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella

Family

NAC

Protein Properties

Length: 229aa MW: 25776.4 Da PI: 9.2729

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Carubv10017972m	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	112.6	4.3e-35	3	79	52	129
NAM 52 kaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 k +ekewyfF+ +d+ky+tg+r+nratksgyWkatgkdke+++ +++lvg+kktLvfykgrapkg+kt+Wvmheyrle Carubv10017972m 3 KIGEKEWYFFCVKDRKYPTGSRTNRATKSGYWKATGKDKEIFK-GKTLVGMKKTLVFYKGRAPKGVKTNWVMHEYRLE 79 45789************************************.999***************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	39.149	1	103	IPR003441	NAC domain
SuperFamily	SSF101941	1.96E-38	3	103	IPR003441	NAC domain
Pfam	PF02365	4.3E-17	8	78	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009611	Biological Process	response to wounding
GO:0042542	Biological Process	response to hydrogen peroxide
GO:0051091	Biological Process	positive regulation of sequence-specific DNA binding transcription factor activity
GO:1900057	Biological Process	positive regulation of leaf senescence
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 229 aa Download sequence Send to blast
MAKIGEKEWY FFCVKDRKYP TGSRTNRATK SGYWKATGKD KEIFKGKTLV GMKKTLVFYK 60 GRAPKGVKTN WVMHEYRLEG EFAIDDLPKT AKNECVISRV FHKRADGTKM HISGLMFGSG 120 VNKFEPVGLP PLMDSSLYLK NREDSLSLFS HVTCFSDQTY DDKSLVSDPL LLQEDSSILK 180 MLLDNEETQF KKNLQSSGSS ESGLTASSWH GHTPYSSGPV NLDCVWNF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	3e-31	2	109	66	171	NO APICAL MERISTEM PROTEIN
1ut4_B	3e-31	2	109	66	171	NO APICAL MERISTEM PROTEIN
1ut7_A	3e-31	2	109	66	171	NO APICAL MERISTEM PROTEIN
1ut7_B	3e-31	2	109	66	171	NO APICAL MERISTEM PROTEIN
3swm_A	4e-31	2	109	69	174	NAC domain-containing protein 19
3swm_B	4e-31	2	109	69	174	NAC domain-containing protein 19
3swm_C	4e-31	2	109	69	174	NAC domain-containing protein 19
3swm_D	4e-31	2	109	69	174	NAC domain-containing protein 19
3swp_A	4e-31	2	109	69	174	NAC domain-containing protein 19
3swp_B	4e-31	2	109	69	174	NAC domain-containing protein 19
3swp_C	4e-31	2	109	69	174	NAC domain-containing protein 19
3swp_D	4e-31	2	109	69	174	NAC domain-containing protein 19
4dul_A	3e-31	2	109	66	171	NAC domain-containing protein 19
4dul_B	3e-31	2	109	66	171	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[AG]CGT[AG](4-5n)[AG][CT]ACGCAA-3' (PubMed:16359384, PubMed:21303842). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:21303842). {ECO:0000269\|PubMed:16359384, ECO:0000269\|PubMed:21303842}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Carubv10017972m

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Rapidly and strongly induced by H(2)O(2) treatment in both leaves and roots. Accumulates during senescence and in response to wounding. {ECO:0000269\|PubMed:21303842}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY062638	1e-105	AY062638.1 Arabidopsis thaliana Unknown protein (MRI12.1) mRNA, complete cds.
GenBank	BT008716	1e-105	BT008716.1 Arabidopsis thaliana At3g29035 gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006291582.1	1e-169	NAC domain-containing protein 59
Swissprot	Q9LJW3	1e-119	NAC59_ARATH; NAC domain-containing protein 59
TrEMBL	R0H5E2	1e-169	R0H5E2_9BRAS; Uncharacterized protein
STRING	XP_006291582.1	1e-168	(Capsella rubella)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G29035.1	1e-112	NAC domain containing protein 3

Link Out ? help Back to Top
Phytozome	Carubv10017972m
Entrez Gene	17886488

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Manacorda CA, et al. Salicylic acid determines differential senescence produced by two Turnip mosaic virus strains involving reactive oxygen species and early transcriptomic changes. Mol. Plant Microbe Interact., 2013. 26(12): p. 1486-98 [PMID:23945002] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]