PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Carubv10018341m

Common Name

CARUB_v10018341mg

Organism

Capsella rubella

Taxonomic ID

81985

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella

Family

S1Fa-like

Protein Properties

Length: 77aa MW: 8230.93 Da PI: 10.608

Description

S1Fa-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Carubv10018341m	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	S1FA	136.4	6.7e-43	8	76	2	70
S1FA 2 avakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 ++a++eakG+nPGlivllvvg +ll fl++ny+lyvyaqknlPPrkkkPvskkklkreklkqGv+vPGe Carubv10018341m 8 GKAAAEAKGMNPGLIVLLVVGVPLLAFLIANYVLYVYAQKNLPPRKKKPVSKKKLKREKLKQGVPVPGE 76 57899***************************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04689	6.3E-38	12	76	IPR006779	DNA binding protein S1FA
ProDom	PD019013	2.0E-5	13	76	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0016021	Cellular Component	integral component of membrane
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 77 aa Download sequence Send to blast
MDGDDFAGKA AAEAKGMNPG LIVLLVVGVP LLAFLIANYV LYVYAQKNLP PRKKKPVSKK 60 KLKREKLKQG VPVPGE*

Functional Description ? help Back to Top
Source	Description
UniProt	DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Carubv10018341m

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF370176	3e-95	AF370176.1 Arabidopsis thaliana unknown protein (At3g53370) mRNA, complete cds.
GenBank	AY059136	3e-95	AY059136.1 Arabidopsis thaliana unknown protein (At3g53370) mRNA, complete cds.
GenBank	AY088845	3e-95	AY088845.1 Arabidopsis thaliana clone 97045 mRNA, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006292137.1	3e-46	DNA-binding protein S1FA1
Swissprot	Q42337	4e-21	S1FA2_ARATH; DNA-binding protein S1FA2
TrEMBL	R0HIL4	6e-45	R0HIL4_9BRAS; Uncharacterized protein
STRING	Cagra.0612s0062.1.p	1e-45	(Capsella grandiflora)
STRING	XP_006292137.1	1e-45	(Capsella rubella)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM33502	2	2

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G37120.1	2e-13	S1FA-like DNA-binding protein

Link Out ? help Back to Top
Phytozome	Carubv10018341m
Entrez Gene	17886153