![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Carubv10018752m | ||||||||
| Common Name | CARUB_v10018752mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 174aa MW: 18880 Da PI: 5.9914 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 177 | 1.8e-55 | 26 | 120 | 1 | 95 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
vreqdrflPian+srimk+ lP n+ki+kdaket+qecvsefisfvtseasdkcqrekrktingddllwa+atlGfe+y+eplkvyl++yre +
Carubv10018752m 26 VREQDRFLPIANISRIMKRGLPLNGKIAKDAKETMQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFEEYIEPLKVYLMRYREGD 119
69*****************************************************************************************966 PP
NF-YB 95 g 95
+
Carubv10018752m 120 T 120
5 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.3E-52 | 24 | 136 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.3E-39 | 29 | 148 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.5E-27 | 32 | 96 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.8E-21 | 60 | 78 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 63 | 79 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 2.8E-21 | 79 | 97 | No hit | No description |
| PRINTS | PR00615 | 2.8E-21 | 98 | 116 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 174 aa Download sequence Send to blast |
MAESQTGGGG GSHESGGDQS PRSLNVREQD RFLPIANISR IMKRGLPLNG KIAKDAKETM 60 QECVSEFISF VTSEASDKCQ REKRKTINGD DLLWAMATLG FEEYIEPLKV YLMRYREGDT 120 KGSGKGGESS GKRDGQPSQV SQFSQLPQQG SFSQGPYGNS QASNMMVQMP GTE* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 6e-47 | 26 | 117 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 6e-47 | 26 | 117 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Carubv10018752m |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK176827 | 0.0 | AK176827.1 Arabidopsis thaliana mRNA for transcription factor NF-Y, CCAAT-binding - like protein, complete cds, clone: RAFL25-38-H16. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010504090.1 | 1e-109 | PREDICTED: nuclear transcription factor Y subunit B-10-like | ||||
| Swissprot | Q67XJ2 | 1e-110 | NFYBA_ARATH; Nuclear transcription factor Y subunit B-10 | ||||
| TrEMBL | R0H7X6 | 1e-124 | R0H7X6_9BRAS; Uncharacterized protein | ||||
| STRING | XP_006292521.1 | 1e-125 | (Capsella rubella) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM1480 | 27 | 94 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G53340.1 | 2e-95 | nuclear factor Y, subunit B10 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Carubv10018752m |
| Entrez Gene | 17886257 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




