![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Carubv10024343m | ||||||||
| Common Name | CARUB_v10024343mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 119aa MW: 13387.2 Da PI: 7.4165 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 174.8 | 9e-55 | 28 | 119 | 1 | 92 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92
vreqdrflPian+srimk+ lP n+ki+kdake+vqecvsefisf+tseasdkcqrekrktingddllwa+atlGfe+y+eplk+yl++yre
Carubv10024343m 28 VREQDRFLPIANISRIMKRGLPPNGKIAKDAKEIVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEEYIEPLKLYLMRYRE 119
69*****************************************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.2E-50 | 26 | 119 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.06E-37 | 31 | 119 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 7.2E-28 | 34 | 98 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.7E-21 | 62 | 80 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 65 | 81 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.7E-21 | 81 | 99 | No hit | No description |
| PRINTS | PR00615 | 1.7E-21 | 100 | 118 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 119 aa Download sequence Send to blast |
MAESQAKSPG GGGSHESGGD QSPRSLHVRE QDRFLPIANI SRIMKRGLPP NGKIAKDAKE 60 IVQECVSEFI SFITSEASDK CQREKRKTIN GDDLLWAMAT LGFEEYIEPL KLYLMRYRE |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_B | 5e-48 | 26 | 119 | 1 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 5e-48 | 26 | 119 | 1 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Carubv10024343m |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY070477 | 1e-146 | AY070477.1 Arabidopsis thaliana At2g37060/T2N18.18 mRNA, complete cds. | |||
| GenBank | AY091673 | 1e-146 | AY091673.1 Arabidopsis thaliana At2g37060/T2N18.18 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_023640153.1 | 1e-84 | nuclear transcription factor Y subunit B-8 | ||||
| Refseq | XP_023640154.1 | 1e-84 | nuclear transcription factor Y subunit B-8 | ||||
| Swissprot | Q8VYK4 | 2e-81 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | R0HVN6 | 2e-83 | R0HVN6_9BRAS; Uncharacterized protein (Fragment) | ||||
| STRING | Cagra.0666s0039.1.p | 5e-84 | (Capsella grandiflora) | ||||
| STRING | XP_006295255.1 | 4e-84 | (Capsella rubella) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM1480 | 27 | 94 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G37060.3 | 2e-71 | nuclear factor Y, subunit B8 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Carubv10024343m |
| Entrez Gene | 17889072 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




