![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Carubv10024393m | ||||||||
| Common Name | CARUB_v10024393mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 99aa MW: 11915.5 Da PI: 9.5859 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 25.1 | 4e-08 | 33 | 72 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
+T++E++l+ + +++ G + W++Ia ++ gR +k++ +w
Carubv10024393m 33 MTEQEEDLIFRMHRLVGDR-WDLIAGRVV-GRDAKEIERFWI 72
7****************99.*********.*********995 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 9.8E-6 | 29 | 77 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.62E-5 | 32 | 71 | No hit | No description |
| Pfam | PF00249 | 1.7E-7 | 33 | 72 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.1E-9 | 34 | 72 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.3E-6 | 34 | 81 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 99 aa Download sequence Send to blast |
MDNTNRRSRR KQTIFTLRDS EEVSSIEWEF INMTEQEEDL IFRMHRLVGD RWDLIAGRVV 60 GRDAKEIERF WIMRNSDHFS HKRCRLHKSS RFCISSSP* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation. May function by suppressing the expression of GL3. {ECO:0000269|PubMed:22168948}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Carubv10024393m |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006295305.1 | 3e-66 | MYB-like transcription factor TCL2 isoform X1 | ||||
| Swissprot | B3H4X8 | 4e-46 | TCL2_ARATH; MYB-like transcription factor TCL2 | ||||
| TrEMBL | R0HVS8 | 6e-65 | R0HVS8_9BRAS; Uncharacterized protein | ||||
| STRING | XP_006295305.1 | 1e-65 | (Capsella rubella) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM323 | 28 | 194 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G30424.1 | 2e-48 | MYB_related family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Carubv10024393m |
| Entrez Gene | 17888572 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




