PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Carubv10024964m

Common Name

CARUB_v10024964mg

Organism

Capsella rubella

Taxonomic ID

81985

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella

Family

MYB_related

Protein Properties

Length: 88aa MW: 10841.3 Da PI: 8.4952

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Carubv10024964m	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	27.5	7.2e-09	38	77	4	45
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +T++E++l+++ k+ G + W++Iar++ gR +k++ +w Carubv10024964m 38 MTEQEEDLIYRMYKLVGDR-WDLIARRVV-GREAKEIERFWI 77 7**************99.*****.*******995 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00717	8.4E-6	34	82	IPR001005	SANT/Myb domain
CDD	cd00167	2.31E-5	37	76	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.2E-9	38	77	IPR009057	Homeodomain-like
Pfam	PF00249	6.6E-8	38	77	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	4.79E-7	39	77	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MENTDRFHLC RPHGHKQSKF TQYDFQEVSS IKWEFINMTE QEEDLIYRMY KLVGDRWDLI 60 ARRVVGREAK EIERFWIMRN SDHFSRK*

Functional Description ? help Back to Top
Source	Description
UniProt	MYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation by direct binding to the cis-acting regulatory elements of GL1, thus suppressing the expression of GL1. {ECO:0000269\|PubMed:17933793}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Carubv10024964m

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006295837.1	4e-60	MYB-like transcription factor TCL1
Swissprot	D3GKW6	8e-41	TCL1_ARATH; MYB-like transcription factor TCL1
TrEMBL	R0HTK4	9e-59	R0HTK4_9BRAS; Uncharacterized protein
STRING	XP_006295837.1	2e-59	(Capsella rubella)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM323	28	194

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G30432.1	3e-43	MYB_related family protein

Link Out ? help Back to Top
Phytozome	Carubv10024964m
Entrez Gene	17890522

Publications ? help Back to Top
Alexandrov NN, et al. Features of Arabidopsis genes and genome discovered using full-length cDNAs. Plant Mol. Biol., 2006. 60(1): p. 69-85 [PMID:16463100] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zheng K, et al. Ectopic expression of R3 MYB transcription factor gene OsTCL1 in Arabidopsis, but not rice, affects trichome and root hair formation. Sci Rep, 2016. 6: p. 19254 [PMID:26758286] Hegebarth D,Buschhaus C,Wu M,Bird D,Jetter R The composition of surface wax on trichomes of Arabidopsis thaliana differs from wax on other epidermal cells. Plant J., 2016. 88(5): p. 762-774 [PMID:27496682] Tian H, et al. NTL8 Regulates Trichome Formation in Arabidopsis by Directly Activating R3 MYB Genes TRY and TCL1. Plant Physiol., 2017. 174(4): p. 2363-2375 [PMID:28649093]