![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Carubv10027148m | ||||||||
| Common Name | CARUB_v10027142mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 205aa MW: 23835.3 Da PI: 9.3882 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 94.5 | 4.8e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+ien + rqvtfskRrng+lKKA+ELSvLCda+v++iifs++g+lye+ss
Carubv10027148m 9 KKIENATSRQVTFSKRRNGLLKKAYELSVLCDAQVSLIIFSQRGRLYEFSS 59
68***********************************************96 PP
| |||||||
| 2 | K-box | 46.5 | 1.6e-16 | 78 | 165 | 5 | 97 |
K-box 5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97
++++ +e ++l+qe++ L +i+ L+ +R+llG+++ s+sl+eLq++ +qL++sl K +l+ eq+e+l+ kek+l +en +L++k
Carubv10027148m 78 TSNHDSEIYLQQLKQEASHLITKIDHLEFHKRRLLGQGIASCSLEELQEIDSQLQRSLG-----KAQLFSEQVEKLKAKEKQLLDENVKLHQK 165
3444677889******************999***************************7.....89*************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 8.7E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 32.394 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.0E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 9.42E-34 | 3 | 83 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 8.22E-44 | 3 | 78 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 8.3E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.0E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.0E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 5.8E-16 | 87 | 165 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 9.482 | 87 | 172 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009838 | Biological Process | abscission | ||||
| GO:0009909 | Biological Process | regulation of flower development | ||||
| GO:0010150 | Biological Process | leaf senescence | ||||
| GO:0080187 | Biological Process | floral organ senescence | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 205 aa Download sequence Send to blast |
MVRGKIEMKK IENATSRQVT FSKRRNGLLK KAYELSVLCD AQVSLIIFSQ RGRLYEFSSS 60 DMKKTIERYR KYTKDHETSN HDSEIYLQQL KQEASHLITK IDHLEFHKRR LLGQGIASCS 120 LEELQEIDSQ LQRSLGKAQL FSEQVEKLKA KEKQLLDENV KLHQKSVIET WRGSNEQQEK 180 CRVIDLNLDV QTDLFIGLPN RHCS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 5e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 5e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 5e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 5e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
| 5f28_A | 6e-22 | 1 | 82 | 1 | 83 | MEF2C |
| 5f28_B | 6e-22 | 1 | 82 | 1 | 83 | MEF2C |
| 5f28_C | 6e-22 | 1 | 82 | 1 | 83 | MEF2C |
| 5f28_D | 6e-22 | 1 | 82 | 1 | 83 | MEF2C |
| 6bz1_A | 6e-22 | 1 | 92 | 1 | 90 | MEF2 CHIMERA |
| 6bz1_B | 6e-22 | 1 | 92 | 1 | 90 | MEF2 CHIMERA |
| 6bz1_C | 6e-22 | 1 | 92 | 1 | 90 | MEF2 CHIMERA |
| 6bz1_D | 6e-22 | 1 | 92 | 1 | 90 | MEF2 CHIMERA |
| 6c9l_A | 5e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 5e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 5e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 5e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 5e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 5e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00576 | DAP | Transfer from AT5G62165 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Carubv10027148m |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY054220 | 0.0 | AY054220.1 Arabidopsis thaliana At2g45660/F17K2.19 mRNA, complete cds. | |||
| GenBank | AY065206 | 0.0 | AY065206.1 Arabidopsis thaliana unknown protein (At5g62165) mRNA, complete cds. | |||
| GenBank | AY066035 | 0.0 | AY066035.1 Arabidopsis thaliana At2g45660/F17K2.19 mRNA, complete cds. | |||
| GenBank | AY096509 | 0.0 | AY096509.1 Arabidopsis thaliana unknown protein (At5g62165) mRNA, complete cds. | |||
| GenBank | AY141213 | 0.0 | AY141213.1 Arabidopsis thaliana MADS-box protein AGL42 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006281112.1 | 1e-148 | MADS-box protein AGL42 isoform X2 | ||||
| Swissprot | Q9FIS1 | 1e-128 | AGL42_ARATH; MADS-box protein AGL42 | ||||
| TrEMBL | R0GNV1 | 1e-146 | R0GNV1_9BRAS; Uncharacterized protein | ||||
| STRING | Cagra.4003s0006.1.p | 1e-145 | (Capsella grandiflora) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G62165.3 | 1e-131 | AGAMOUS-like 42 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Carubv10027148m |
| Entrez Gene | 17876295 |




