PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Carubv10028496m

Common Name

CARUB_v10028496mg

Organism

Capsella rubella

Taxonomic ID

81985

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella

Family

NF-YB

Protein Properties

Length: 190aa MW: 20455.5 Da PI: 6.7955

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Carubv10028496m	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	185.7	3.6e-58	26	121	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 reqdrflPianvsrimkk+lPanakiskdaket+qecvsefisfvt+easdkcq+ekrktingddllwa++tlGfedyveplkvyl+++re+eg Carubv10028496m 26 REQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEG 119 89******************************************************************************************** PP NF-YB 96 ek 97 e+ Carubv10028496m 120 ER 121 97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.5E-54	20	135	IPR009072	Histone-fold
SuperFamily	SSF47113	1.71E-41	28	138	IPR009072	Histone-fold
Pfam	PF00808	1.1E-28	31	95	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	7.2E-21	59	77	No hit	No description
PROSITE pattern	PS00685	0	62	78	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	7.2E-21	78	96	No hit	No description
PRINTS	PR00615	7.2E-21	97	115	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 190 aa Download sequence Send to blast
MGDSDRDSGG GQNGNNQNGQ SSLSPREQDR FLPIANVSRI MKKALPANAK ISKDAKETMQ 60 ECVSEFISFV TGEASDKCQK EKRKTINGDD LLWAMTTLGF EDYVEPLKVY LQRFREIEGE 120 RTGLGRPQTA AEAGEHQRDA VGDAGGFYGG GGMQYHQHHQ FLHQQNHMYG ATGGGSNGGG 180 GAASGRTRT*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	2e-48	26	116	2	92	Transcription factor HapC (Eurofung)
4g92_B	2e-48	26	116	2	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Carubv10028496m

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB025628	0.0	AB025628.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MNJ7.
GenBank	AF385744	0.0	AF385744.1 Arabidopsis thaliana AT5g47640/MNJ7_23 mRNA, complete cds.
GenBank	AY078026	0.0	AY078026.1 Arabidopsis thaliana AT5g47640/MNJ7_23 mRNA, complete cds.
GenBank	CP002688	0.0	CP002688.1 Arabidopsis thaliana chromosome 5 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006282223.1	1e-140	nuclear transcription factor Y subunit B-2
Swissprot	Q9FGJ3	9e-87	NFYB2_ARATH; Nuclear transcription factor Y subunit B-2
TrEMBL	R0F1G8	1e-138	R0F1G8_9BRAS; Uncharacterized protein
STRING	XP_006282223.1	1e-139	(Capsella rubella)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM255	28	229

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G47640.1	4e-84	nuclear factor Y, subunit B2

Link Out ? help Back to Top
Phytozome	Carubv10028496m
Entrez Gene	17876943

Publications ? help Back to Top
Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Xu F, et al. DELLA proteins physically interact with CONSTANS to regulate flowering under long days in Arabidopsis. FEBS Lett., 2016. 590(4): p. 541-9 [PMID:26801684] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722] Gnesutta N, et al. CONSTANS Imparts DNA Sequence Specificity to the Histone Fold NF-YB/NF-YC Dimer. Plant Cell, 2017. 29(6): p. 1516-1532 [PMID:28526714]