PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cc04_g16620

Common Name

GSCOC_T00035769001

Organism

Coffea canephora

Taxonomic ID

49390

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea

Family

ZF-HD

Protein Properties

Length: 91aa MW: 9602.72 Da PI: 8.6203

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cc04_g16620	genome	CGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	106.7	1.4e-33	24	80	3	60
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +vrY eC+kNhAaslGg+avDGC+Efm+s geegt+ al+CaACgCHRnFHR+eve++ Cc04_g16620 24 TVRYAECQKNHAASLGGYAVDGCREFMAS-GEEGTSGALTCAACGCHRNFHRKEVESS 80 79************************9.999*******************9875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	2.0E-22	1	75	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	3.3E-31	25	77	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	7.7E-28	26	77	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	26.188	27	76	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 91 aa Download sequence Send to blast
MKKRQIVVRK EGSRRCSSGS AVRTVRYAEC QKNHAASLGG YAVDGCREFM ASGEEGTSGA 60 LTCAACGCHR NFHRKEVESS VAEAVSESSS *

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027126883.1	4e-58	mini zinc finger protein 2-like
Swissprot	Q9LJW5	2e-32	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	A0A068UUU8	8e-57	A0A068UUU8_COFCA; Uncharacterized protein
STRING	XP_009591850.1	5e-41	(Nicotiana tomentosiformis)
STRING	XP_010037168.1	6e-41	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1105	24	86

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	2e-31	mini zinc finger 2

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]