![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cc05_g01060 | ||||||||
| Common Name | GSCOC_T00000905001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 102aa MW: 11650.6 Da PI: 10.6538 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 99.8 | 1.9e-31 | 18 | 71 | 2 | 55 |
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
prlrWtpeLHe+FveaveqLGG+++AtP++i ++m+v gL ++hvkSHLQ+YR+
Cc05_g01060 18 PRLRWTPELHEHFVEAVEQLGGKHEATPRRIIQMMGVRGLQVSHVKSHLQMYRS 71
8****************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 11.237 | 14 | 74 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 2.9E-29 | 15 | 75 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 7.88E-16 | 18 | 75 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 1.5E-23 | 18 | 72 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 2.9E-10 | 19 | 70 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 102 aa Download sequence Send to blast |
MESCNKTGVR QYKKSACPRL RWTPELHEHF VEAVEQLGGK HEATPRRIIQ MMGVRGLQVS 60 HVKSHLQMYR SMKKRTTIHL VVPAMLHEKE TPDSVVPSPP R* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6j4k_A | 2e-19 | 18 | 75 | 3 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4k_B | 2e-19 | 18 | 75 | 3 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_A | 2e-19 | 18 | 75 | 3 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_C | 2e-19 | 18 | 75 | 3 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_D | 2e-19 | 18 | 75 | 3 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_F | 2e-19 | 18 | 75 | 3 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_H | 2e-19 | 18 | 75 | 3 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_J | 2e-19 | 18 | 75 | 3 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Putative transcription factor. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_027101755.1 | 3e-62 | uncharacterized protein LOC113722706 | ||||
| Swissprot | Q700D9 | 8e-23 | MYBF_ARATH; Putative Myb family transcription factor At1g14600 | ||||
| TrEMBL | A0A068VCM9 | 1e-68 | A0A068VCM9_COFCA; Uncharacterized protein | ||||
| STRING | POPTR_0002s05770.1 | 9e-33 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA9459 | 13 | 25 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38300.1 | 1e-26 | G2-like family protein | ||||




