![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Cc06_g03710 | ||||||||
| Common Name | GSCOC_T00023660001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 89aa MW: 9878.64 Da PI: 10.2853 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 132.1 | 1.4e-41 | 22 | 88 | 4 | 70 |
S1FA 4 akveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
+++eakG+nPGlivll+vggl+l flvgny ly+yaqk+lPP+kkkPvskkk+kre+lkqGv++PGe
Cc06_g03710 22 VETEAKGFNPGLIVLLLVGGLILAFLVGNYFLYMYAQKTLPPKKKKPVSKKKMKRERLKQGVSAPGE 88
689***************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD019013 | 0.002 | 23 | 88 | No hit | No description |
| Pfam | PF04689 | 2.8E-40 | 24 | 88 | IPR006779 | DNA binding protein S1FA |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 89 aa Download sequence Send to blast |
MDYEQDFGDR VPPSFDSRNM GVETEAKGFN PGLIVLLLVG GLILAFLVGN YFLYMYAQKT 60 LPPKKKKPVS KKKMKRERLK QGVSAPGE* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC232935 | 9e-56 | AC232935.1 Solanum lycopersicum chromosome 9 clone C09HBa0067J16, complete sequence. | |||
| GenBank | HG975521 | 9e-56 | HG975521.1 Solanum lycopersicum chromosome ch09, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_027072975.1 | 2e-57 | DNA-binding protein S1FA-like | ||||
| Refseq | XP_027175428.1 | 2e-57 | DNA-binding protein S1FA-like | ||||
| Swissprot | P42553 | 2e-16 | S1FA1_ORYSJ; DNA-binding protein S1FA1 | ||||
| TrEMBL | A0A068UDW6 | 1e-56 | A0A068UDW6_COFCA; Uncharacterized protein | ||||
| STRING | Lus10015073 | 1e-27 | (Linum usitatissimum) | ||||
| STRING | Lus10023177 | 1e-27 | (Linum usitatissimum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA3174 | 22 | 49 |




